KEGG   Rattus norvegicus (rat): 315591Help
Entry
315591            CDS       T01003                                 

Gene name
Tbcel, Lrrc35, RGD1308880
Definition
(RefSeq) tubulin folding cofactor E-like
  KO
K22449  tubulin-specific chaperone cofactor E-like protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    315591 (Tbcel)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     315591 (Tbcel)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_9 LRR_4 LRR_8 Ubiquitin_2 ubiquitin LRR_6
Motif
Other DBs
NCBI-GeneID: 315591
NCBI-ProteinID: NP_001014111
RGD: 1308880
Ensembl: ENSRNOG00000032364
UniProt: Q5PQJ7
Position
8q22
AA seq 424 aa AA seqDB search
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGI
TCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSNPLSLSVLERT
CAGSFSGVRKLVLNNSKASWETVHTILQELPDLEELFLCLNDYETVSCPSVCCHSLKLLH
ITDNNLQEWTEIRKLGVMFPSLDTLVLANNHVNAIEEPADSLARLFPNLRSISLHKSGLQ
SWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVARLPSVSKLNGSVVTDGEREDS
ERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEVSIR
LDQTVAELKRQLKTLVQLPTSSMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIFVE
SKTK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcctagtgggagaagtttcatgcaagtattgtgtgaaaagtacagtcctgaa
aacttcccttaccgccgtggtcctgggatgggagtccatgtcccagccactcctcagggc
tctcctatgaaagatcgcctcaacctcccaagcgtgctcgtgctgaacagctgcgggatt
acctgtgcgggagacgaaagagaaatcgcagccttctgcgctcacgtgtcagagctcgat
ctttctgacaacaagctccaagactggcatgaggtcagtaagattgtgtcaaacgttcct
caactggagtttctcaacctgagttccaatcctctgagtttgtcagttttagaaagaaca
tgcgctgggtccttctctggggttcgcaaacttgtcctcaacaacagcaaagcatcatgg
gaaacagtgcacacaatactgcaggagttgccagatttggaggagctcttcctgtgcctt
aatgactatgaaacagtgtcttgtccttctgtttgctgtcattcccttaagctcctacac
ataacagacaataacctccaagagtggactgaaatccgaaagctgggtgtaatgttccct
tcgctggataccctggtcctggccaacaatcacgtgaatgccatcgaggagcctgctgac
tccctggctaggttgttccctaatctgcggtccatcagcctccacaagtcaggtttgcag
tcctgggaagacattgacaaactcaattcattccccaaactcgaagaagtgagattgtta
ggaatccctctcctgcagccatataccaccgaggagcgcaggaaattggtggtagccaga
ttgccctccgtttccaagctcaatggcagtgttgtgacggatggtgagcgcgaggattct
gagaggttcttcatccggtactatgtggatgttccccaggaggaagtgccattcaggtat
catgagctcattacaaagtatgggaaactggagcctttggcagaagtggacctgagaccc
cagagcagtgcgaaagtcgaagtccacttcaacgaccaggtggaggaagtgagcatccgt
ctggaccagacggtggcggagctgaagagacagctgaagactctggtgcagctgcccacg
agcagcatgctcctctactactttgaccacgaggccccgtttggcccggaggagatgaag
tacagctcgcgagctctgcactctttcggcattagggatggagacaaaatttttgtggaa
tcaaaaacaaaataa

DBGET integrated database retrieval system