KEGG   Rattus norvegicus (rat): 315598Help
Entry
315598            CDS       T01003                                 

Gene name
C1qtnf5
Definition
(RefSeq) C1q and tumor necrosis factor related protein 5
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: C1q Collagen BclA_C
Motif
Other DBs
NCBI-GeneID: 315598
NCBI-ProteinID: NP_001012123
RGD: 1308802
Ensembl: ENSRNOG00000007613
UniProt: Q5FVH0 A0A3B0ITJ1
Position
8q22
AA seq 243 aa AA seqDB search
MRPLLALLLLGLASGSPPLDDNKIPSLCPGQPGLPGTPGHHGSQGLPGRDGRDGRDGAPG
APGEKGEGGRPGLPGPRGEPGPRGEAGPVGAIGPAGECSVPPRSAFSAKRSESRVPPPAD
TPLPFDRVLLNEQGHYDATTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGQSIASFFQ
FFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSP
VFA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaggccacttcttgccctgctgcttctgggtctggcatcaggctctcctcctctggac
gacaacaagatccccagcctgtgtcccgggcagcccggcctcccaggcacaccaggccac
cacggcagccaaggcctgcctggccgtgacggccgtgatggccgcgacggtgcacccgga
gctccgggagagaaaggcgagggcgggagaccgggactacctgggccacgtggggagccc
gggccgcgtggagaggcaggacctgtgggggctatcgggcctgcgggggagtgctcggtg
cccccacgatcagccttcagtgccaagcgatcagagagccgggtacctccgccagccgac
acacccctacccttcgaccgtgtgctgctcaatgagcagggacattacgatgccactacc
ggcaagttcacctgccaagtgcctggtgtctactactttgctgtccatgccactgtctac
cgggccagcctacagtttgatcttgtcaaaaatggccaatccatagcttctttcttccag
ttttttggggggtggccaaagccagcctcgctctcagggggtgcgatggtgaggctagaa
cctgaggaccaggtatgggttcaggtgggtgtgggtgattacattggcatctatgccagc
atcaaaacagacagtaccttctctggatttctcgtctattctgactggcacagctcccca
gtcttcgcttaa

DBGET integrated database retrieval system