KEGG   Rattus norvegicus (rat): 315600
Entry
315600            CDS       T01003                                 

Gene name
Vps11
Definition
(RefSeq) VPS11 CORVET/HOPS core subunit
  KO
K20179  vacuolar protein sorting-associated protein 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    315600 (Vps11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    315600 (Vps11)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    315600 (Vps11)
   Hops complex
    315600 (Vps11)
SSDB
Motif
Pfam: VPS11_C Clathrin zf-C3HC4_2 zf-RING_2 zf-RING_UBOX zf-rbx1 zf-C3HC4 zf-C3H2C3 zf-RING_5 zf-C3HC4_3 TPR_11 DLP_helical zf-ANAPC11 zf-RING-like DUF5847 zf-C3HC4_4 zf-RING_11
Other DBs
NCBI-GeneID: 315600
NCBI-ProteinID: NP_001101608
RGD: 1308038
Ensembl: ENSRNOG00000010733
UniProt: D3ZTB4
Position
8q22
AA seq 878 aa
MEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILASVGEDEEGINPLVKIWNLEKRDG
GNPLCTRILPAIPGTEPTVVSCLTVHENLNFMAIGFTDGSVTLNKGDITRDRHSKTQILH
KGSYPVTGLAFRQAGKTTHLFVVTTENVQSYIVSGKDYPRVELDTHGCGLRCSALSDPSQ
DLQFIVAGDECVYLYQPDERGPCFAFEGHKLIAHWFRGYLVIVSRDRKVSPKSEFTSRDS
QNSDKQILNIYDLCNKFIAYSAVFEDVVDVLAEWGSLYVLTRDGRVHALQEKDTQTKLEM
LFKKNLFEMAINLAKSQHLDSDGLAQIFMQYGDHLYSKGNHDGAVQQYIRTIGKLEPSYV
IRKFLDAQRIHNLTAYLQTLHRQSLANADHTTLLLNCYTKLKDSSKLEEFIKTKSESEVH
FDVETAIKVLRQAGYYSHALYLAENHAHHEWYLKIQLEDIKNYQEALRYIGKLPFEQAES
NMKRYGKILMHHIPEQTTQLLKGLCTDYRPSLEGRGDREFPSCRANSEEFIPIFANNPRE
LKAFLEHMSEVQPDSPQGIYDTLLELRLQNWAHEKDPQAKEKLHAEAISLLKSGRFCDVF
DKALVLCQMHDFQDGVLYLYEQGKLFQQIMHYHMQHEQYRQVIAVCERHGEQEPSLWEQA
LSYFARKEEDCKEYVAAVLRHIENKSLMPPLLVVQTLAHNSTATLSIIRDYLVQKLQKQS
QQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFH
QHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLKCSNDSFSVIADYFG
RGVFNKLTLLTDPPTARLTPSLEAGLQRDLLMHSRRGT
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggaaggccagatctggttcttgccacgttctctacagcttacagggttccaggcctac
aagctacgggtgacacacttgtatcagctgaagcagcacaatattctggcatcagttggt
gaggatgaagagggcattaaccccctggtaaagatctggaacctggagaagagagatggt
ggcaatccactctgcactcggatcctccctgccatcccagggacagagccaactgtcgtg
tcttgtttgaccgtccatgagaatctcaacttcatggccattggcttcacggatggcagt
gtcactctgaacaagggagatattacccgggacaggcacagcaagacccagattttgcac
aagggcagctatcctgttactggactggcttttcgccaggcaggaaagaccactcacttg
tttgtcgtgacaactgaaaatgttcagtcctacatagtttcaggaaaggactaccctcgc
gtggagttggacacccatggttgtggcctgcgctgttcggccctcagcgacccttctcag
gacctgcagttcattgtcgctggagatgagtgtgtctacctttaccagccggatgaacgc
gggccctgctttgcctttgagggccataagctcatcgcccactggtttagaggctacctt
gtcattgtctcccgtgaccggaaggtttctcccaagtcggagtttaccagcagggactca
cagaactctgacaagcaaattctcaacatctatgacctgtgcaacaagttcatagcctac
agcgctgtttttgaggatgtagtggatgtgctcgctgagtggggctccctgtacgtgctg
accagggatgggcgggtccacgcattgcaggagaaggacacacagaccaaactggagatg
ctgtttaagaagaatctctttgagatggcaattaacctggctaagagtcagcatctggac
agtgatgggctagctcaaatcttcatgcagtatggagaccatctctacagcaaaggcaac
catgatggggctgttcagcagtatatccgaaccattgggaagttggagccgtcctatgtg
atccgtaaatttctagatgcccaacgcatccacaacctgactgcctacctacaaactctg
catcggcaatctctggctaatgccgatcacaccaccctgctcctgaactgctataccaag
ctcaaggacagctcgaagctggaggaattcatcaagacgaagagcgagagtgaagtccac
tttgatgtggagacagccatcaaggtcctccggcaggctggctactactcccatgccctt
tatctggctgagaaccacgcacatcatgagtggtacttaaagatccagctagaggacatt
aagaactatcaggaagcccttcggtatatcggcaagctgccttttgagcaggcagagagt
aacatgaaacgctatggcaagatcctcatgcaccacataccagagcagacaacccagttg
ctgaaaggcctctgtactgactatcggcccagtctggaaggccgaggcgatcgggagttt
ccaagctgccgggccaactccgaggagttcatccccatctttgcaaacaacccaagagag
ctgaaagccttcctggagcacatgagcgaagtgcagccagactcaccccagggcatctat
gacacgctcctggagctacggctgcagaactgggcccatgagaaggatccacaggccaag
gagaaacttcatgcagaggccatctccctgctgaagagtggccgattctgtgatgtgttt
gacaaggcattggtcctgtgccagatgcatgacttccaggatggggtcctttacctctat
gagcaggggaagctgttccagcagatcatgcattaccacatgcagcacgagcagtatcgg
caggtgattgctgtgtgtgaacgccatggggagcaggagccctccctgtgggagcaggcc
ctcagctacttcgcccgcaaggaggaagactgcaaggagtatgtggcagccgtgcttaga
cacatcgagaacaagagcctgatgccacctctcctggtggtacagacgctggcacacaac
tccacagctactctgtccatcatccgagattacctggtccaaaaactgcagaaacagagc
cagcagattgcacaggatgagcttcgggtgcggcggtacagagaggagaccactcgcatc
cgccaggaaatccaagagctcaaggcgagtccaaagattttccagaagaccaagtgcagc
atctgtaacagtgccttggagctgccttcagtccacttcctgtgtggccactccttccac
caacactgctttgagagctactcagaaagtgatgctgactgccccacctgcctccctgag
aatcggaaggtgatggatatgatccgggcccaggaacagaaacgagatctccatgatcaa
ttccagcatcagctcaagtgctcgaatgacagcttctccgtgattgcggactactttggc
cgaggggttttcaacaagctgactctgctgaccgatccccctacagccagactgaccccc
agcctggaggctgggctacagcgggacctgctgatgcactccaggaggggaacgtaa

DBGET integrated database retrieval system