KEGG   Rattus norvegicus (rat): 315611
Entry
315611            CDS       T01003                                 

Gene name
Scn4b
Definition
(RefSeq) sodium voltage-gated channel beta subunit 4
  KO
K04848  voltage-gated sodium channel type IV beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    315611 (Scn4b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    315611 (Scn4b)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   315611 (Scn4b)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2 Glycophorin_A DUF4229 Ig_6 DUF1673 Syndecan
Other DBs
NCBI-GeneID: 315611
NCBI-ProteinID: NP_001008880
RGD: 631404
Ensembl: ENSRNOG00000026679
UniProt: Q7M730
Position
8q22
AA seq 228 aa
MSRAGNRGNTQARWLGIGLLGLFLLPMYLSLEVSVGKATTIYAINGSAILLPCTFSSCYG
FENLYFRWSYNNSETSRILIDGIVKNDKSDPKVRVKDDDRITLEGSTKEKMNNISILLSD
LEFSDTGRYTCFVRNPKEKDLNNSATIFLQVVDKLEEVDNTVTLIILAVVGGVIGLLVCI
LLLKKLITFILKKTREKKKECLVSSSGNDNTENGLPGSKAEEKPPTKV
NT seq 687 nt   +upstreamnt  +downstreamnt
atgtcccgggctgggaaccgaggcaatactcaggcgagatggctgggcattgggcttttg
ggtctcttcctgctccccatgtacctgtcgttggaggtatctgtgggaaaggccaccacc
atctacgctatcaacggctcagcgatcctgctaccctgcaccttctccagctgttatggc
tttgagaacctctacttcaggtggtcctacaataacagcgaaacatccaggattctcatc
gacgggatcgtgaagaatgataagtctgaccctaaggtgagagtgaaggatgatgaccgc
atcaccctagagggctccactaaggagaagatgaataacatctccatcctcttgagtgac
ctggagttcagtgacacgggcagatacacttgcttcgtgaggaaccccaaggagaaggac
ttaaacaactctgctacgatcttcctccaagtggttgataaattggaagaagtggacaac
acagtgacgctcatcatcctggctgtggtaggcggggtcatcggacttctcgtctgcatc
ctgttgctgaagaagctcatcactttcatcctgaagaagaccagagagaagaagaaggag
tgtctcgtgagttcctctgggaacgacaacacagagaacgggctgcctggttccaaggca
gaagagaagccacccacaaaagtgtga

DBGET integrated database retrieval system