KEGG   Rattus norvegicus (rat): 315615Help
Entry
315615            CDS       T01003                                 

Gene name
Dscaml1
Definition
(RefSeq) DS cell adhesion molecule-like 1
  KO
K06768  Down syndrome cell adhesion molecule-like protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    315615 (Dscaml1)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  DSCAM family
   315615 (Dscaml1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 Ig_2 ig V-set C2-set_2 Ig_6 C1-set Receptor_2B4 Pur_ac_phosph_N Interfer-bind fn3_2 ChitinaseA_N
Motif
Other DBs
NCBI-GeneID: 315615
NCBI-ProteinID: NP_001101611
RGD: 1304887
Ensembl: ENSRNOG00000016502
UniProt: D3ZPL7
Position
8q22
AA seq 2111 aa AA seqDB search
MTGAGEPRREEPPPCAGLRSRESGAPSAGGWERAERGRGAAARPATGPPPRRKGPLYGMW
LVTFLLLLDSLHKARPEDVGTSLYFVNDSLQHVTFSSSVGVVVPCPAAGSPSAALRWYLA
TGDDIYDVPHIRHVHANGTLQLYPFSPSAFNSFIHDNDYFCTAENAAGKIRSPNIRIKAV
FREPYTVRVEDQRSMRGNVAVFKCLIPSSVQEYVSVVSWEKDTVSITPENRFFITSHGGL
YISDVQKEDALSTYRCITQHKYSGETRQSNGARLSVTDPAESIPTILDGFHSQEVWTGHA
VELPCAASGYPIPAIRWLKDGRPLPADSRWAKRITGLTISDLRTEDSGTYICEVTNTFGS
AEANGVLTVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRNTELVLPGEAIS
IRGLSNETLLISSAQKSHSGAYQCFATRKAQTAQDFAIIVLEDGTPRIVSSFSEKVVNPG
EQFSLMCAAKGAPPPTVTWALDDEPVVRDGSHRTNQYTMSDGTTISHMNVTGPQIRDGGV
YRCTARNSVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYKDA
LLLPDNHRQVVFENGTLKLTDVQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQPF
EFPPASIGQLLYIPCVVSSGDMPIRITWRKDGQVIISGSGVTIESKEFMSSLQISSVSLK
HNGNYTCIASNAAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKVM
WKHAKGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTDISKAMF
LTVKIPAMITSHPNTTIAIKGHAKELNCTARGERPIIIRWEKGDTVIDPDRVMRYAIATK
DNGDEVVSTLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELEIREVKARS
MNLRWTQRFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANIVDLHPASVYSIRM
YSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGIIRGY
QIGYRENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEIN
ATTLEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYVDGEWGEM
QNVTTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKEDVPGPPAGIKAVPS
SASSVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSPEQLFYRIAHLNRGQQYL
LWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWLKDVRLPCNSVGDPAPAVK
WTKDSEDSAIPVSLDGHRLIHTNGTLLLRAVKAEDSGYYTCTATNTGGFDTIIVNLLVQV
PPDQPRLTVSKTSASSITLTWIPGDNGGSSIRGFVLQYSVDNSEEWKDVFISSSERSFKL
DSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHLFTHINSTHARLNLQG
WNNGGCPITAIVLEYRPKGTWAWQGVRANSSTEVFLTELREATWYELRMRACNSAGCGNE
TAQFATLDYDGSTIPPIKSAQGEGDDVKKLFTIGCPVILATLGVALLFVVRKKRKEKRLK
RLRDAKSLAEMLISKNNRSFDTPVKGPPQGPRLHIDIPRVQLLIEDKEGIKQLGDDKATI
PVTDAEFSQAVNPQSFCTGVSLHHPALIQSTGPLIDMSDIRPGTNPVSRKNVKSAHSTRN
RYSSQWTLTKCQASTPARTLTSDWRTVGSQHGVTVTESDSYSASLSQDTDKGRNSMVSTE
SASSTYEELARAYEHAKLEEQLQHAKFEITECFISDSSSDQMTTGTNENADSMTSMSTPS
EPGICRFTASPPKPQDADRGKNVAVPIPHRANKSDYCNLPLYTKSEAFFRKADGREPCPV
VPPREASMRNLTRAYHTQARHLTLDPASKPLGLPHPGATAATATATLPQRTLAMPAPPAG
TAPPAPGPTPSEPSAPPSAAPPAPSTEPPRAGGPHTKMGGSRDSLLEMSTPGVGRSQKQG
AGAYSKSYTLV
NT seq 6336 nt NT seq  +upstreamnt  +downstreamnt
atgacaggagccggggagccgaggagggaggagccgccgccgtgcgctgggctgaggagc
agagagagcggggcgccgagtgcgggcggctgggagcgcgctgagcgggggagaggcgct
gccgcacggccggccacaggaccacctccccggagaaaagggcctctttatggcatgtgg
ctggtaactttcctcctgctcctggactctttacacaaagcccgccctgaagatgttggc
accagcctctactttgtaaatgactccctgcagcacgtaaccttctccagctctgtgggt
gtggtggtgccctgcccggccgctggatcccccagtgcggctcttcgatggtacctggcc
acgggggacgacatctacgatgtgccacacatccggcacgtgcatgccaacgggactctg
cagctctaccctttctccccctccgccttcaatagctttatccacgacaatgactatttc
tgcaccgcagagaacgcagccggcaagatccggagccctaacattcgcatcaaagcagtt
ttcagggaaccctacaccgtccgggtggaggatcaaaggtcaatgcgtggcaacgtggct
gtcttcaagtgcctcatcccctcttcagtgcaggaatacgttagcgtcgtgtcttgggag
aaagacacagtctccatcactccagaaaacaggtttttcatcacatcacacggtgggctg
tacatctcggacgtgcagaaggaagatgctctctctacctaccgctgcatcactcagcac
aaatacagtggggagactcgtcagagcaacggggctcggctctctgtgacagaccctgca
gagtccatccccaccatcctggatggcttccactcccaggaagtgtggaccggccacgca
gtcgagctgccctgtgctgcctctggctaccccatccctgccatccgctggctcaaagat
ggcagacccctccctgctgacagccgctgggctaagcgcattacagggctgaccatcagt
gatctgcgcactgaggacagcggcacctacatctgtgaggtcaccaacaccttcgggtca
gcagaggccaacggcgtcctcacagtcattgaccctcttcatgtgaccctgacaccaaag
aagctgaagacgggcatcgggagcacggttatcctgtcctgcgccctcaccggctccccg
gagttcaccatccgctggtaccgcaacacagaactggtgctgcccggtgaggccatctcc
atccgcgggcttagcaatgaaactctgcttatctcctcggcacagaagagccactcgggg
gcctaccagtgcttcgccacccgaaaggcccagacagcgcaggactttgccatcatcgtg
ctggaagacggcacgccccgcatcgtctcatccttcagcgagaaggtggtcaaccccggg
gagcagttctcattgatgtgtgccgccaagggcgccccgccccccacggtcacctgggcc
ctggacgacgagcctgtcgtgcgggatggaagccaccgcaccaaccagtacaccatgtcc
gacggcaccaccatcagccacatgaacgtcacgggtccccagatccgggatgggggcgtg
taccggtgcacagcgcggaactcggtgggcagtgctgaatatcaggcgcgaataaacgta
agaggaccccccagcatccgggcaatgaggaacatcacggcagtcgccgggcgggacaca
ctcatcaactgcagggtcatcggctacccctactactctatcaagtggtacaaggatgcc
ctgctgctaccagataaccaccgccaggtggtgtttgagaacgggaccctcaagctgacg
gacgtgcagaagggcatggatgagggagagtacctgtgcagtgtgctcatccagccgcag
ctttccatcagccagagtgtccatgtggccgtcaaagtgccccctctgatccagcccttt
gagttcccccctgcctccatcggccagctgctctacatcccctgtgtggtgtcctcgggg
gacatgcccatccgcatcacctggagaaaggacggacaggtgatcatctcaggctcaggc
gtgaccatcgagagcaaggaattcatgagctccctgcagatctccagcgtctccctcaaa
cacaatggcaactacacttgcattgccagcaacgcagcggccaccgtgagcagggagcgc
cagctcatcgtgcgcgtgccccctcgatttgtggtgcagcccaacaaccaggatggcatc
tatggcaaagctggtgtgctcaactgctcggtagatggctacccgccacccaaggtcatg
tggaagcatgccaaagggagtgggaaccctcagcaatatcacccagtgcccctcactggc
cgcatccagatcctgcccaacagctccctgctgatacgccacgtcctggaagaggacatc
ggctactacctctgccaggccagcaacggtgtgggcactgacatcagcaaggccatgttc
ctcacggtgaaaatcccagccatgatcacgtcgcaccccaacaccactatcgccatcaag
ggccacgccaaggagctgaactgcactgcgcgtggcgagcggcccatcataatccgctgg
gagaagggggacaccgtcattgatcccgaccgtgtcatgcggtatgccattgctaccaag
gacaatggcgatgaggtggtctccacgcttaagctcaagccagccgaccgtggggactcc
gtgttcttcagctgccatgctatcaactcatacggagaggaccggggtttgatccagctc
actgtgcaagagccccctgaccccccagagctggagatccgggaggtgaaggcccggagc
atgaacctgcgttggactcagagatttgatggaaacagtatcatcactggctttgatatc
gagtacaagaacaaatcagattcatgggattttaagcagtccacccgtaacatctcccca
accatcaaccaggcgaacatcgtagatttacacccagcatcggtgtacagcatccgcatg
tactccttcaacaagattgggcgcagcgagccgagcaaggagcttactatcagtacagag
gaagccgctcctgatgggcctcccatggatgtcaccttgcaaccagtgacttcacagagc
atccaggtgacctggaaggcaccaaagaaggagctgcaaaatggaatcatccggggatac
cagattggctacagggagaacagccccggtagcaatgggcagtacagcattgtggaaatg
aaggcgacgggggacagcgaggtctacacgctggataacctcaagaagttcgctcagtac
ggcgtggtggtccaagccttcaaccgggccggcacggggccctcatccagtgagatcaat
gccaccaccttggaggatgtgcccagccagcccccagagaatgtccgagctctgtccatc
acttctgacgtggctgtcatctcctggtcggaacccccacgaagcaccctcaacggggtc
ctcaaaggctaccgggtcatcttctggtcactctacgttgacggagagtggggcgagatg
cagaatgtcaccaccacaagagagcgagtggagctgcggggtatggagaagttcaccaac
tacagcgtccaggtgctcgcctacacgcaggctggggatggtgtgcgcagcagcgtgctc
tatatccagaccaaggaagatgttccaggcccccctgctggcatcaaagctgtcccttca
tcagctagcagtgtggtcgtgtcctggttgcccccaaccaagcccaatggggtgatccga
aaatacaccatcttttgttccagccctgggtccggccagccggctcccagcgagtacgag
accagtcctgaacagctcttctacaggatcgcccatctgaaccggggccagcagtacttg
ctatgggtggctgcggtcacctctgcaggccgggggaacagcagcgagaaggtcaccatc
gagcctgctggcaaggccccagcaaagatcatctcctttggaggcactgtaacgacaccc
tggttgaaagatgtccgactgccttgcaactccgtgggagacccagccccggctgtgaag
tggaccaaggacagtgaagactcagccatccccgtgtctttggatggacaccggctcatc
cacacaaacggtacactgctgcttcgcgctgtgaaggctgaagactccggctattacacc
tgcacagcaaccaacaccggtggctttgacaccatcatcgtcaaccttctggtacaagtt
cccccagaccagccccgcctcactgtctccaaaacctccgcctcttccatcaccctgacc
tggattccaggggacaatgggggcagctccatcagaggcttcgtgctacagtactctgtg
gataacagcgaggagtggaaggatgtgttcatcagttccagtgagcgctccttcaagcta
gacagcctcaagtgtggcacgtggtacaaggtgaagctggcggccaagaacagtgtgggc
tctgggcgcatcagcgagatcatcgaggccaagacccatgggcgggaaccttccttcagc
aaagaccaacacctcttcacccacatcaactctacacatgctcggcttaacctgcagggc
tggaacaatgggggctgccccatcacagccattgtcctggagtaccggcccaaggggacc
tgggcctggcagggcgtccgagccaacagttccacagaggtgtttctgacagaacttcga
gaggctacctggtatgagctccgcatgagggcttgcaacagtgccggctgtggcaatgag
accgcccagtttgccaccctggactacgatggcagcaccatcccccccatcaagtctgct
caaggagaaggagatgatgtgaagaagttgttcaccatcggctgtccagtcatcctggcc
accctcggggtggcgctgctctttgttgtaagaaagaagaggaaggagaaacggctgaag
aggctccgagatgcaaagagtttggcagaaatgctgataagcaagaacaaccgaagcttt
gacactcctgtgaaagggccaccccagggtccacggctccacattgacatcccgagggtt
cagctgctcattgaggacaaggagggcatcaagcagctgggagatgacaaggccaccatt
cctgtaaccgatgctgagttcagtcaagctgtcaacccacagagcttctgtactggtgtc
tctttgcatcatcctgcccttatccagagcacgggacccctcatcgacatgtcagacatc
cggccaggaaccaatccagtatccaggaagaacgtgaaatcagcccacagcacccggaac
cggtactcaagccagtggaccttgaccaagtgccaggcctccacccctgcccgaaccctc
acctccgactggcgcactgtgggttcccagcatggtgtcactgtcactgagagcgacagc
tacagtgccagtctatcccaagacacagacaaagggagaaacagcatggtatccactgag
agtgcttcctccacctatgaggagctggcccgggcctatgagcacgccaagctggaggag
cagctgcagcacgccaagtttgaaatcacagagtgcttcatctcggacagctcctcggac
cagatgaccacgggcaccaacgagaacgccgacagcatgacatctatgagtacaccctca
gagcctggcatctgccgcttcactgcctctccacccaagccgcaggatgctgacaggggc
aagaacgtggctgtgcccatccctcaccgagccaacaagagtgactactgtaacctgcca
ctgtataccaagtcagaggccttcttccgaaaggcagatgggcgggagccctgccctgtg
gtcccaccccgagaggcctccatgaggaacctgactcgagcctaccatacccaggcccgg
cacctcactctggaccctgccagcaagcccttgggcctcccccatccaggggccaccgct
gccaccgccacggccaccttacctcagaggactctggccatgccggcacccccagctggc
acggcacccccagcacctggccctactcccagtgagccctctgctcctcctagtgctgcc
cctccggcccccagcactgaacctccacgggccggaggcccacacaccaaaatggggggc
tccagggactcactactcgaaatgagcaccccaggggtggggcgttctcagaaacagggg
gctggagcctattccaaatcctacaccctggtgtag

DBGET integrated database retrieval system