KEGG   Rattus norvegicus (rat): 315617Help
Entry
315617            CDS       T01003                                 

Gene name
Sidt2, RGD1308311
Definition
(RefSeq) SID1 transmembrane family, member 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SID-1_RNA_chan
Motif
Other DBs
NCBI-GeneID: 315617
NCBI-ProteinID: NP_001101612
RGD: 1308311
Ensembl: ENSRNOG00000017871
UniProt: D3ZEH5 A0A0A0MP80
Position
8q22
AA seq 979 aa AA seqDB search
MTSAGGRSPAVYRGAAPGGPEFCAASAALKGPASGKPTGQGHRRLGSPGASGRRVSSRAG
PGWGCGSRCRPREPGSARGPGAAPGRGRVLSQAGVKVLVPVRCWKLLRQPQRARSPSRRQ
PPPPRAMIAWRLPLCVLLVAAVESHLGALGPKNVSQKDAEFERTYADDVNSELVNIYTFN
HTVTRNRTEGVRVSVNVLNKQKGAPLLFVVRQKEAVVSFQVPLILRGLYQRKYLYQKVER
TLCQPPTKNESEIQFFYVDVSTLSPVNTTYQLRVNRVDNFVLRTGELFTFNTTAAQPQYF
KYEFPDGVDSVIVKVTSKKAFPCSVISIQDVLCPVYDLDNNVAFIGMYQTMTKKAAITVQ
RKDFPSNSFYVVVVVKTEDQACGGSLPFYPFVEDEPVDQGHRQKTLSVLVSQAVTSEAYV
GGMLFCLGIFLSFYLLTVLLACWENWRQRKKTLLVAIDRACPESGHPRVLADSFPGSAPY
EGYNYGSFENGSGSTDGLVESTGSGDLSYSYQGHDQFKRRLPSGQMRQLCIAMDRSFDPV
GARPRLDSMSSVEEDDYDTLTDIDSDKNVIRTKQYLCVADLARKDKRVLRKKYQIYFWNI
ATIAVFYALPVVQLVITYQTVVNVTGNQDICYYNFLCAHPLGNLSAFNNILSNLGYILLG
LLFLLIILQREINHNRALLRNDLYALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNY
TNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAF
WIVFSVIHIISTLLLSTQLYYMGRWKLDSGIFRRILHVLYTDCIRQCSGPLYTDRMVLLV
MGNIINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIV
CTSVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSFLV
LLTLDDDLDTVQRDKIYVF
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcagcgggcgggcgcagccccgctgtttaccgcggcgcggcgcctggtggcccc
gagttctgtgccgcgtccgccgcccttaaagggcccgcgtccgggaagcctacgggccag
ggccaccgccgcctcggctctccgggcgcgagcggacgccgggtctccagccgggctggg
ccgggctggggttgcgggtcgcggtgccgcccacgcgagccggggtccgcgcgaggccca
ggagcggctccagggaggggacgcgtcctatctcaggccggggttaaagttctggtcccg
gtgagatgctggaagctgctgcggcagccgcaacgcgcccggtcgccgtcccgtcgccag
cccccgccgccccgggccatgatcgcctggcgtctgcccttgtgcgtgctcctggtggcc
gccgtcgagagccacctgggggctctggggcccaagaacgtctcgcagaaagacgcggag
tttgagcgcacctacgcggacgacgtcaacagcgagctagtcaacatctacaccttcaac
cacaccgtgacccgcaaccggaccgagggcgtgcgagtgtctgtgaacgtcctgaacaaa
cagaaaggggcgcctttgctgttcgtggtccgccagaaggaggctgttgtgtccttccag
gtgcccctaatcctgcgagggctataccagcgtaagtacctctaccaaaaagttgaacga
actctgtgtcagccccccaccaagaatgagtctgagatccagtttttctatgtggatgtg
tctaccctgtcaccagtcaataccacttaccagctccgagtcaaccgtgtggacaatttc
gtgctcaggactggggagctgtttaccttcaataccactgcagcccaaccccagtacttc
aaatacgagtttcctgatggtgtggactctgtcattgtcaaggtgacctccaagaaggcc
ttcccctgctctgtcatctccatccaggatgtcctgtgcccagtctatgatcttgacaac
aatgtagccttcatcggcatgtaccagacaatgactaagaaggcagccatcactgtgcag
aggaaagacttccccagcaacagtttttatgtggtggtggtggtgaagactgaggaccag
gcctgcggggggtccttgcccttctaccctttcgtggaagatgaaccagtggatcaaggg
caccgtcagaaaaccctgtcagtgctggtctctcaggctgtcacttctgaggcctacgtt
ggtgggatgctcttttgcctgggcatattcctgtcgttctacctgctgactgtgctgctg
gcctgttgggagaactggaggcaaaggaagaagaccttgctggtggccatagaccgagcc
tgcccagaaagcggtcaccctcgggtcttggctgattcgtttcctggcagtgccccctat
gagggttacaactatggctcctttgagaatggttccggatccactgacgggttggttgaa
agcacaggttcaggggacctctcctacagttaccaggggcacgaccagttcaagcggcgc
cttccctctggccagatgcggcagctgtgcattgccatggaccgctcctttgacccagtg
ggagctcggccacgactggactccatgagctccgtggaagaggatgactatgacacactg
actgacatcgactcagacaaaaacgtcattcgaaccaagcaatacctctgtgtggctgat
ctggcacgaaaggacaaacgtgttttacggaaaaagtaccagatttacttctggaacata
gccaccattgcagtcttctacgcccttcctgtggtgcagctggtgatcacctaccagacg
gtggtgaatgtcacggggaaccaggacatctgctactacaacttcctctgtgcccaccca
ctgggcaacctcagcgccttcaacaacatcctcagcaacctggggtacattctgcttggt
ctgctcttcctgctcatcatcctgcagcgggagatcaatcataaccgggccctgctgaga
aatgacctctatgctctggagtgtgggatccccaaacactttggtctattttatgccatg
ggcacagcgttgatgatggaggggctactgagtgcctgttaccacgtctgccccaactac
accaacttccagttcgatacctcgttcatgtacatgattgctggcctctgcatgctgaag
ctctaccagaagcggcacccagatatcaacgccagcgcctacagcgcatacgcctgcctg
gccattgtgatcttcttctccgtcctgggtgtggtttttggcaaagggaacacagccttc
tggatcgtcttctcagtcatccatatcatttccacgcttctcctcagcactcagctgtat
tacatgggccgctggaagctggactccggaatcttccgccgcatccttcatgtgctctac
acagactgcatccggcagtgcagcgggcccctttacacggaccgcatggtgcttctggtc
atgggcaacattatcaactggtcgctggctgcctacggactcatcatgcgcccaaatgac
tttgcgtcctacttgctggcaattggcatctgcaacttgctgctgtattttgctttctac
atcattatgaagctccggagcggcgagaggatcaagctcatccctctgctctgcatcgtg
tgcacctccgtggtctggggcttcgcactcttcttcttcttccagggactcagcacgtgg
cagaaaacccccgcagagtccagggagcacaaccgagactgcatcctccttgacttcttt
gatgaccacgacatctggcacttcctgtcctccattgctatgtttgggtccttcctggtt
ttattgacgttggatgacgacttggacactgtacagcgggacaagatctatgtcttctag

DBGET integrated database retrieval system