KEGG   Rattus norvegicus (rat): 315655Help
Entry
315655            CDS       T01003                                 

Gene name
Rdx
Definition
(RefSeq) radixin
  KO
K05762  radixin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
rno04810  Regulation of actin cytoskeleton
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    315655 (Rdx)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    315655 (Rdx)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    315655 (Rdx)
   05205 Proteoglycans in cancer
    315655 (Rdx)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    315655 (Rdx)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   315655 (Rdx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERM FERM_M FERM_C FERM_N NeA_P2
Motif
Other DBs
NCBI-GeneID: 315655
NCBI-ProteinID: NP_001005889
RGD: 1359472
Ensembl: ENSRNOG00000012237
UniProt: Q5PQK5
Position
8q24
AA seq 583 aa AA seqDB search
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTMK
AQKELEEQTRKALELEQERQRAKEEAERLDRERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMCAPPPPPPPAVVP
PTENEHDEQDEHSAEASAELSSEGVTNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaccaataaatgtaagagtaactacaatggatgctgaactagagtttgccatt
cagcccaatacaactggcaaacaactttttgaccaggttgtaaaaacagttggtttacgt
gaggtctggttttttgggctgcaatatgtagacagcaaaggatattccacatggcttaaa
ctgaataaaaaggtaacacagcaagatgttaaaaaagaaaatcctttacagttcaagttt
agagctaaattctttcctgaagatgtttctgaggaattgattcaagaaataacacagaga
cttttcttcttgcaagttaaagaagccatcttaaatgatgagatatattgcccaccagaa
actgcagttcttttggcttcgtatgctgttcaagccaagtatggagattataataaagag
attcataaaccaggctatctggctaatgacagactcctaccacagcgtgttttggaacaa
cataaactgaccaaagagcagtgggaggagagaatacagaactggcatgaagaacacagg
gggatgctaagggaagattcaatgatggaatacttgaagattgcacaagatctagagatg
tatggtgtcaactactttgaaatcaagaataagaagggtactgagctgtggctgggcgtt
gatgctttgggtctgaatatttatgagcatgatgacaagttaacacctaaaattggtttt
ccctggagtgaaatccgaaatatttcgtttaatgacaaaaaatttgttataaagccaatt
gacaaaaaggcacctgattttgttttctatgcacctcgtctgagaatcaataagcgaatt
ttggccttatgtatgggaaaccatgagctgtacatgcgaaggagaaagcctgatactatt
gaagtacagcagatgaaggctcaggcccgggaggagaaacaccagaagcagctagaacgg
gcacaattagagaatgaaaagaagaaacgagaaatagcagaaaaggaaaaggaaagaata
gaacgggaaaaggaagagctgatggaacgtctaaggcaaattgaagagcagacaatgaaa
gcccagaaagaactagaagaacagactcggaaagccctggaactggagcaggagcgccag
cgagcaaaagaggaggcagagcggctagacagggagcgccgggctgcggaagaggccaag
tccgcaatagccaagcaagctgctgaccaaatgaagaaccaggagcagctggcagcagaa
cttgccgaattcactgccaagattgcacttttagaagaagccaagaagaaaaaggaagag
gaagctacggagtggcagcataaagcttttgcagctcaggaagacttggaaaagaccaaa
gaagagttaaaaactgtgatgtgtgcgccccctccgccgccccctcccgcagtcgtccct
cccacagagaacgagcatgatgagcaggacgagcacagtgccgaggccagcgccgagctg
tccagtgagggcgtgacgaaccacaggagcgaggaggagcgggtgacggagacccagaag
aacgaacgcgtgaagaagcagctccaggcattaagttcagaattagcccaagcgagagat
gaaaccaagaagacacagaatgatgttctccatgctgagaacgtcaaggcaggccgtgat
aagtacaagactctgcggcagattcgacaaggcaacaccaagcagcgcatcgatgagttt
gaagcaatgtga

DBGET integrated database retrieval system