KEGG   Rattus norvegicus (rat): 315691Help
Entry
315691            CDS       T01003                                 

Gene name
Lingo1, Lrrn6a
Definition
(RefSeq) leucine rich repeat and Ig domain containing 1
  KO
K23533  leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    315691 (Lingo1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    315691 (Lingo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 Ig_2 LRR_9 ig LRRNT V-set
Motif
Other DBs
NCBI-GeneID: 315691
NCBI-ProteinID: NP_001094192
RGD: 1308668
Ensembl: ENSRNOG00000017193
UniProt: G3V881 Q562A6
Position
8q24
AA seq 620 aa AA seqDB search
MQVSERMLAGGMRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRK
RFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFN
LRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLV
YISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYR
LKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPIG
TIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESAFHSVGN
LETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFT
CRRAHIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDG
TLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGE
ANSTRATVPFPFDIKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPR
KSDAGISSADAPRKFNMKMI
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgagcgagaggatgctggcagggggtatgagaagcatgcccagccccctcctg
gcctgctggcagcccatcctcctgctggtcctgggctctgtgctgtcaggctccgccacc
ggctgcccgccccgctgcgagtgctcagcgcaggaccgagcagtgctctgtcaccgcaag
cgctttgtggcggtgcccgagggcatccccaccgagactcgcctgctggacctgggcaaa
aaccgcatcaagacactcaaccaggacgagtttgccagtttcccacacctggaggagcta
gaactcaatgagaacattgtgagcgctgtggagccgggcgccttcaacaacctcttcaac
ctgaggacgctggggcttcgcagcaaccgcctgaagctcatcccgctgggcgtcttcacc
ggcctcagcaacttgaccaagctggacatcagcgagaacaagatcgtcatcctgctagac
tacatgttccaagacctatacaacctcaagtcgctggaggtcggcgacaatgacctcgtc
tacatctcccatcgagccttcagcggcctcaacagcctggaacagctgacgctggagaaa
tgcaatctgacctccatccccactgaggcactctcccacctgcatggcctcatcgtcctg
cggctacgacacctcaacatcaatgccatacgggactactccttcaagaggctgtaccga
ctcaaggtcttagagatctcccactggccctacctggacaccatgacccccaactgcctc
tacggcctcaacctgacatccctatctatcacgcactgcaacctgacagccgtgccctat
ctggcagtgcgccacctggtctatctccgtttcctcaatctttcctacaaccccatcggt
acaatcgagggctccatgctgcatgagctgctgcggttgcaagagatccaactggtgggc
gggcagctggccgtggtggagccctacgcctttcgtgggctcaattacctgcgtgtgctc
aatgtttctggcaaccagctgaccaccctggaggagtcagccttccactcggtgggcaac
ctggagacgctcattctggactccaacccactggcctgtgactgccggctgctgtgggtg
ttccggcgccgctggcggctcaacttcaacaggcagcagcctacctgcgccacacctgag
ttcgtccagggcaaggagttcaaggacttccccgatgtgctcctacccaactacttcacc
tgccgccgggcccacatccgggaccgcaaggcacagcaggtgtttgtagatgagggccac
acggtgcagttcgtatgccgggcagatggcgaccctccaccagctatcctttggctctca
ccccgcaagcacttggtctcagccaagagcaatgggcggctcacagtcttccctgatggc
acgctggaggtgcgctacgcccaggtacaggacaacggcacgtacctgtgcatcgcagcc
aatgcaggcggcaacgactccatgcccgcccacttgcatgtgcgcagctactcgcctgac
tggccccatcaacccaacaagaccttcgccttcatctccaaccagccaggcgagggagag
gccaacagcacccgcgccactgtgcctttccccttcgacatcaagacgctcatcatcgcc
accaccatgggcttcatctccttcctgggcgtggtcctattctgcctggtgctgctgttt
ctatggagccggggcaaaggcaacacaaagcacaacatcgaaattgaatatgtgccccgg
aaatcggacgcaggcatcagctcagctgatgcaccccgcaagttcaacatgaagatgata
tga

DBGET integrated database retrieval system