KEGG   Rattus norvegicus (rat): 315695
Entry
315695            CDS       T01003                                 

Gene name
Odf3l1, RGD1304976
Definition
(RefSeq) outer dense fiber of sperm tails 3-like 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SHIPPO-rpt
Other DBs
NCBI-GeneID: 315695
NCBI-ProteinID: NP_001101621
RGD: 1304976
Ensembl: ENSRNOG00000027109
UniProt: D4A5D6
Position
8q24
AA seq 275 aa
MKQFERARNYVFYAQHPEKEEEVPSWQEIKQTPVVMATIKGPGPAKYLRPSCTGYIAHDI
SMFQEPAFSLHTRHTKKRITDENSPGPCYFLDPKVTRFGISTCPQVPMEERIPNLRITST
PASCYYNLQKTQPSGERRPPQYSFGYRCPYRVMDPNPAPNRYKLPSSLGPNVPNLSTAPC
YGLASTNKNWFHKENIAGGPGPAMRTRPEPSVYQNRSPVFSMAKRFAYPLDHTLRPGPGS
HNIQPVTVHKPRIPAFTMGIKHSPHLCPLIVDICD
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaaacagttcgagagggccaggaactatgtgttctacgcacagcacccagagaaggag
gaagaggtaccctcatggcaggaaatcaagcagacccctgttgtcatggccacaatcaaa
ggtccagggcctgccaagtacctgcggccatcttgtactggctacatagcccatgacatc
tccatgttccaggagccagccttcagtctgcatacacggcacactaagaaacggatcact
gacgaaaacagccctggaccttgctattttttggatcccaaagtaactcgttttggaata
tctacctgtccccaggttcccatggaggagcgcatccccaacctacgcataactagtacg
ccagcctcttgctactacaacctccagaagacccaaccctctggggaacgtaggcctccc
cagtactcttttggctatcggtgtccatatagagtgatggaccccaatccggctcctaac
cggtacaagctgccatcctctctggggcccaacgtccccaacctctcaactgccccttgc
tatggtctggcttccacaaacaagaactggttccacaaggagaatatagcaggaggtcct
ggacctgctatgcgtacgcgacctgagccgtctgtctaccagaaccgcagccccgtgttt
agcatggccaagcgctttgcctaccctctggaccacacacttcggcctggcccaggctcc
cacaacatccagccagtcactgtgcacaagccccgcatccctgccttcaccatgggcatc
aaacactcaccccacttgtgcccattgattgtggacatttgtgactga

DBGET integrated database retrieval system