KEGG   Rattus norvegicus (rat): 315707Help
Entry
315707            CDS       T01003                                 

Gene name
Csk
Definition
(RefSeq) c-src tyrosine kinase
  KO
K05728  c-src tyrosine kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    315707 (Csk)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    315707 (Csk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     315707 (Csk)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  CSK family
   315707 (Csk)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   315707 (Csk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 APH SH3_3
Motif
Other DBs
NCBI-GeneID: 315707
NCBI-ProteinID: NP_001025210
RGD: 1308800
Ensembl: ENSRNOG00000019374
UniProt: P32577
Structure
PDB: 

Position
8q24
AA seq 450 aa AA seqDB search
MSAIQASWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCEGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYDVMK
NCWHLDAATRPTFLQLREQLEHIRTHELHL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctatacaggcctcctggccatccggtacagaatgtattgccaagtacaacttc
catggcactgccgagcaagaccttcccttctgcaaaggagatgtgctcaccattgtggct
gtcaccaaggaccccaactggtacaaagccaaaaacaaagtgggccgtgagggcatcatc
ccagccaactatgtccagaagcgtgagggtgtgaaggcaggcaccaagctcagccttatg
ccctggttccacggcaagatcacacgggagcaggcggagcggcttctctacccaccagag
acaggcctgttcctggtgcgggaaagcaccaactaccctggggactacacactgtgtgtg
agctgtgaaggcaaggtggagcactaccgcatcatgtatcacgcgagcaagctgagcatt
gatgaggaggtgtacttcgagaacctcatgcagctggtggagcactacaccacagatgcc
gacggactctgcactcgcctcatcaaaccaaaggtcatggagggcacagtggcggcccaa
gatgaattctaccgcagtggctgggccctgaacatgaaggaactgaagctgctacagacg
ataggaaagggggagtttggagatgtgatgctgggggattaccgaggcaacaaagttgca
gtcaagtgcattaagaatgatgctacagcccaggccttcctggctgaagcctctgtcatg
acgcagcttcggcacagcaacctagtccagctactgggtgtgattgtggaggagaagggt
gggctctacatcgtcacagagtacatggccaaggggagtttggtggactatcttcgatca
cgtggtcgttcggtgctaggcggagactgtctcctcaaattctcactagacgtctgtgaa
gccatggagtacctggagggtaacaattttgtgcaccgggacttggctgcccggaatgtg
ctggtgtctgaggacaacgtggccaaagtcagtgactttggcctcactaaggaagcttcc
agcactcaggacacaggcaaactgccagtcaagtggacagctcctgaagccttgagagag
aagaaattttccaccaagtctgatgtgtggagtttcggaatccttctctgggaaatctat
tccttcgggcgagtgccttacccaagaattcccctgaaggacgtcgtccctcgggtggaa
aagggctataagatggacgctccggatggctgcccacccgcagtctatgatgttatgaag
aactgctggcacctggatgctgccacgcggcccacctttctgcagcttcgagagcagctc
gagcacatcagaacccatgagctgcacctgtga

DBGET integrated database retrieval system