KEGG   Rattus norvegicus (rat): 315713
Entry
315713            CDS       T01003                                 

Gene name
Pml
Definition
(RefSeq) protein PML isoform X1
  KO
K10054  probable transcription factor PML
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04144  Endocytosis
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    315713 (Pml)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    315713 (Pml)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    315713 (Pml)
   05202 Transcriptional misregulation in cancer
    315713 (Pml)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    315713 (Pml)
  09172 Infectious disease: viral
   05164 Influenza A
    315713 (Pml)
   05168 Herpes simplex virus 1 infection
    315713 (Pml)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    315713 (Pml)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    315713 (Pml)
SSDB
Motif
Pfam: DUF3583 zf-B_box BMFP Prok-RING_4 Imm71 DUF3276 zf-RING_5 DUF4404
Other DBs
NCBI-GeneID: 315713
NCBI-ProteinID: XP_038938327
RGD: 1562602
Ensembl: ENSRNOG00000008400
Position
8
AA seq 925 aa
MPPPEEPSEDHEHSQSPAEQAIKEEFQFLRCPGCQTQAKCPKLLPCLHTLCSGCLEAPGL
QCPICQAPGSANANAEALDNVFFESLQRRLAVFRQIVDAQAACTRCKELADFWCFECEQL
MCGKCFDAHQWYLKHEARPLAELRDNSVREFLDSTRKSNIFCSNTNHRTPAQTNVIMQSP
FILEEMTDPHSTIPPQRSACLLPTNSKPLQVYFIYCRGCAKPLCCECALLDRNHSHLQCE
IGKEIQQLHEELGTMTQALEEQGRTFDSAHAQMHSAIGQLDDARSDTEKQIRARVRQVIE
HVQAQERELLEAVNVRYQRDYQEIAGQLGHLEAVLQRIRTGGALVKRMKLYASEQEVLDM
HGFLRKALCRLRQEEPQNHKVQLRTSGFEEFKLCLQDLVSFITQRTDVAVAGRASPEAAS
THPEAASAQPEAASTHPEAASAQPEAASAHPESASTPGNSTDLEQPKEVQRAQAQAMELS
KTQPVAMVKSVPGAHPVPVYAFSMQGPTYREEASQTVSPMKRKCCHIDCCRKIIKMESTD
ENEDRLSTSSPEQPRPSTSKAISPPHPDGTSSTESTIPEKETPLPNNNHVASDAGETEER
IVVISSSEDSDAENLPSHELDDSSSESSSIQLEGPNSLKALDESLAEPHLEDRTLVFFDL
KIDNETQKISQLAAVNRESKFRVLIQPEAFSVYSKAVSLESGLQHFLSFLNSMHRPLLAC
PRLWGPGLPIFFQALNDINKLWEFQDAISGFLAVLPLIQERIPSASSFKLRNLAKTYLAR
NMSERSALAAVLAMRDLCCLLEVSPGLQLAQHIYSFSSLQCFASLQPLIQAQVLPQPEAR
LLALHNVSFLELLTAYRSNRQEGLKKYVHYLSLQTTPSSASTQIAQFLQALSAYMDGQLE
GHIPAGAEGTALSLSGRAENKGCLA
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgcctcccccagaggaaccctccgaagaccatgaacacagccaaagccccgcggagcaa
gccataaaggaggaatttcagtttctgcgctgcccgggctgccagacccaagccaagtgc
cccaaactgctgccttgcctgcacacgctatgctccggatgcctggaggcgcccggcctg
caatgcccgatctgccaggcaccggggtcggccaatgctaatgcggaggccctggataac
gtgttcttcgagagcctgcagcggcgcctggcggtgttccggcagattgtggatgcgcag
gctgcgtgcactcgctgcaaagagttggctgacttctggtgtttcgagtgtgaacagctc
atgtgtggcaagtgctttgatgcacaccagtggtacctcaaacacgaggcccggcccctg
gccgagctccgcgacaactcagtgcgcgaattcctcgacagtactcgcaagtccaacatc
ttctgctccaataccaaccaccgcactcctgcgcagactaacgtgataatgcagtccccc
ttcatactagaggagatgactgatccccactccacaataccaccacagagaagtgcttgc
cttcttcctacgaactctaagccacttcaagtttacttcatctactgccgaggctgcgcc
aagcctctgtgttgtgaatgcgcgcttctggaccgcaaccacagccatctccagtgtgaa
attggtaaggagatccagcagctgcatgaggagctgggcaccatgacgcaggctctggag
gagcagggcagaaccttcgacagtgcccatgcacagatgcactcagccataggccagttg
gatgacgcacgctcagacactgagaagcagatccgcgcacgcgtgcgccaggtgatagaa
cacgtgcaggctcaggagcgcgagttgctcgaggcggtgaatgtgcgctaccagcgcgac
taccaggaaatagctggccagctgggccacctggaagctgtgctgcagcgcatccgcact
ggtggggcgctggtcaagaggatgaagctctacgcctccgaacaggaggtgctggatatg
catggctttctgcgcaaggcactctgtcgcttgcgccaggaggagcctcagaatcacaaa
gtccagctgcgcaccagcggcttcgaggagttcaagttgtgcctgcaggacctcgtctcc
ttcatcacccagaggacagatgtagctgtagctgggagagccagcccagaggcagccagc
actcacccagaggcagccagcgctcagccagaggcagccagcactcacccagaggcagcc
agcgctcagccagaggcagccagcgctcacccagagtcagccagcactcctgggaactcg
actgaccttgagcagcccaaggaagtgcagagggcacaggctcaggccatggagctgtct
aagacccaacctgtggctatggtaaaatcagtacctggagcacaccctgtaccagtgtat
gccttctctatgcaaggccccacgtacagagaggaggcctctcagacagtcagccccatg
aagaggaagtgctgccacatagattgctgcagaaagattatcaagatggagtccacggat
gagaacgaggacaggttgtcgacaagctcccctgagcagcctaggcccagcacttccaag
gccatctcacctccccatccggatgggacttccagcactgagagcaccatccctgaaaaa
gagacacccctgcccaacaacaaccatgtggccagtgatgcaggggaaacagaggagcga
atcgtagtgatcagcagctcagaggactcagatgccgagaatctgccctcccacgagctg
gacgacagcagcagtgagtccagtagcatccagctggagggccccaattccctcaaggcc
ttggatgagagccttgctgaaccccacttagaagacaggaccctggttttcttcgacctc
aagattgataatgaaacccagaaaattagccaactggctgcggtgaaccgggaaagcaag
ttccgtgtgctcatccagcccgaggccttcagcgtctactctaaggccgtctccctggag
tccgggctgcagcacttcctcagcttcctcaactccatgcaccgtcccctcttggcatgt
cctaggctgtgggggcccggactccccatcttcttccaggccctgaacgacattaacaaa
ctgtgggaattccaggacgccatctcggggttcttggctgtgttgcccctcatccaggaa
cgcatacccagcgccagcagcttcaaacttaggaacctagcgaagacctacctggcgaga
aacatgagcgaacggagtgccttggctgctgtgctggccatgagagatctgtgctgcctc
cttgaggtctccccaggtctgcagctggcccagcatatctactccttcagtagcttacag
tgctttgcttccctgcagcccctaattcaggcacaggtcctgccccagcctgaggcccgc
ctgctggccctccacaatgtgagcttcctagaattgctgaccgcataccgcagcaaccgg
caagagggcttgaagaagtatgtccactatctgagcctgcagaccaccccatcatcagct
tccacccagattgcccaattcctgcaggctctgagtgcctacatggatggacagttggaa
gggcacatccctgctggggcagaaggcactgctctttctctctctggcagagctgaaaat
aagggatgcctggcctag

DBGET integrated database retrieval system