KEGG   Rattus norvegicus (rat): 315728
Entry
315728            CDS       T01003                                 

Gene name
Thsd4
Definition
(RefSeq) thrombospondin type-1 domain-containing protein 4 isoform X1
  KO
K23377  thrombospondin type-1 domain-containing protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    315728 (Thsd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    315728 (Thsd4)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Thrombospondin domain-containing proteins
  ADAMTS-like proteins
   315728 (Thsd4)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_spacer1 TSP_1 ADAM_CR_3 TSP1_CCN TSP1_spondin PLAC
Other DBs
NCBI-GeneID: 315728
NCBI-ProteinID: XP_038938357
RGD: 1566296
Position
8
AA seq 1017 aa
MVSHLTSCLSALGALLLLGSQLVCPQPSTEHRKVPQRMAVAEGTPEDSGGGSPGVWGSWG
PWSACSRSCSGGVMEQTRPCLPSSYRAPAGSRPSGPTLSITGHVVSAVRTSVPLHRSHEE
QRTLAGSSASRQGPTVVRGSRHPQARSREPSERRSRTRGPIGPGKYGYGKAPYILPLQTD
TTHTPQRLRRQRPSSRPSRSQEASASKQGYRPPTHHFSHNRPLYQSDSGPRSGLPPSEAS
IYQLPLTHDQNYPAASSLFHSPELSSNNGARPHGTSQAFSQHLRSTAISCIGAYRQYKLC
NTNACPDSGRSIREVQCASYNNKPFMGRFYEWEPFAEVKGNRKCELNCQATGYRFYVRQA
ERVIDGTPCDQNGTAICVSGQCKSIGCDDFLGSDKVVDKCGVCGGDNTGCQVVSGVFKHA
LTSLGYHRVVEIPQGATKINITEMHKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGTM
FTYKRPNEISSTAGESFLAEGPTNEILDVYMIHQQPNPGVHYEYVIMGNNAISPQVPPHR
RPGEPFNGQLETEDGGQEDREEREKNQEKEDSHVEAPEVFTSESTQTFPVRHPERFPSHR
PDNLVPPAPQHPRRNRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRNTHEEVPESYCDSS
MKPTPEEEPCNLFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQH
LEKPETTSTCQLKICSEWQTRTDWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKLR
PNDIENCDMGPCAKSWFLTEWSERCSAECGAGVRTRSVVCMTNHISSLPLEGCGNNRPAE
ATPCDNGPCTGKVEWFTGSWSQCSVECGSGTQQREVICVRKNADTFEVLDPYECSFLEKP
PSQQACHLKPCGAKWFSTEWSMCSKSCQGGFRVREVRCLSDDMTPGSLCDPQLKPEERES
CNPQDCVPEVDENCKDKYYNCNVVVQARLCVYNYYKTACCASCTRVANRHTGFLGSR
NT seq 3054 nt   +upstreamnt  +downstreamnt
atggtttcccatcttacaagctgtctcagtgccctgggcgccctcctgctgcttggttct
cagcttgtctgcccgcagccctccactgaacacagaaaggtcccacaacggatggcagtg
gccgagggaaccccagaggatagtggtggcggctccccaggtgtgtggggctcctggggc
ccctggtctgcctgttcacgcagctgcagcggtggtgtgatggagcagacacggccctgc
cttcccagctcctaccgcgcaccagcaggctcccggcccagtggccctacactgtccatc
actggccacgttgtgtcagctgtacggacctcagtaccactgcatcgaagccacgaagag
cagcgtaccctggctggctccagtgccagccgccaaggccccacggtggtgcgaggcagc
cgacaccctcaggcccggagccgtgaaccttcagagagaaggagcaggacccgaggtccc
attggccctggcaagtatggctatgggaaggctccctacatcttaccactgcagacggat
accacacatactccacagaggcttcggagacaaaggccttcatccagaccctccaggtcc
caggaggcatctgcttctaagcagggctacaggccaccaacccaccacttctctcacaac
agacctctctaccagagtgacagtggccctcgttctggactgccaccttccgaggcctct
atctaccagctgcccttgactcacgatcaaaactaccctgcagcttcaagtctcttccac
agcccggaattgagcagcaacaatggtgctaggccccacgggacatctcaggccttctct
cagcatctgcgatcaacagcaatctcctgcatcggggcctatcggcagtacaaactgtgc
aacaccaatgcatgtccagacagtggtaggagtatccgggaggtacagtgtgcgtcctac
aacaacaagccattcatgggccgcttttatgaatgggaaccgtttgcagaagtaaagggt
aatcgaaaatgtgagctgaactgccaggcaaccggctaccgcttctacgtccgacaggct
gagagggtcattgacggcacaccctgtgaccagaacggcacggcaatctgcgtgtcgggg
cagtgcaagagcatcggctgtgatgacttcctgggatctgacaaagtcgtggacaagtgt
ggggtgtgcggcggtgataacacgggctgccaggtggtgtcaggcgtgtttaagcatgcc
ctcaccagcctgggctaccaccgggttgtagagattccccaaggagccacaaaaattaac
attacggaaatgcacaagagcaacaactacttggccttgcgaagtcgctctggccgctcc
atcatcaatgggaactgggcaatcgatcgccccgggaagtacgagggcggagggacaatg
ttcacctacaagcgaccgaacgagatctccagcactgccggggagtcctttttggctgaa
ggtcccactaatgagatcctggatgtctatatgatacaccagcagcccaacccaggagtc
cactatgagtacgtgatcatggggaataatgccatcagtccacaggtgccaccacacagg
agaccgggagaacctttcaatgggcagttggaaacagaagatggcggtcaggaggacaga
gaagagagggagaagaaccaggagaaggaagactcacacgtcgaggcccctgaagtattc
acatcagaatccacgcagaccttcccagtcaggcatccggagagattcccttcccaccga
ccagataacttagtgcctccagcaccacagcaccccaggcgaaaccgggaccacaactgg
aagcagctggggacaacagaatgctccaccacctgtgggaaaggatcacagtaccctatc
ttccgctgtgtgcacagaaacacacacgaggaggttcccgagagctactgtgactccagc
atgaagccgaccccagaggaggagccctgcaacctcttcccctgcccagccttctgggac
atcggggagtggtctgaatgcagcaagacctgtggcctgggcatgcagcaccgccaggtc
ctgtgccgccaggtgtatgccaaccgtagcctgacggtgcaaccctaccgctgccagcac
ctggagaagccagagaccaccagcacctgccagctcaagatctgcagcgagtggcagact
cggactgactggacctcgtgctcagtgccctgtggcgtgggacagaggacccgggacgta
aagtgcgtgagcaacattggggacgtagtggacgacgaggagtgcaacatgaagctccga
ccaaatgacatcgaaaactgtgacatgggaccctgtgcaaagagctggttcctcactgaa
tggagcgaaaggtgctcagcagagtgtggggctggggtgaggacacgctcggtggtgtgt
atgaccaaccacatcagcagcctgccattagaaggctgtgggaacaacaggccagcggag
gctacaccatgtgacaatgggccctgcacaggcaaggtggagtggttcactggcagctgg
agtcagtgttccgtcgagtgtggcagtgggacacagcagagggaggtgatctgcgttagg
aagaatgcagacacctttgaagtgctcgacccttatgagtgttcattcctggagaagccc
ccaagccagcaggcctgtcacctcaagccttgtggtgctaagtggttcagcacagaatgg
agcatgtgttccaagagctgtcagggcggattccgggtgcgggaagttcggtgtctctca
gacgacatgaccccgggtagcctctgcgacccccagttgaagccagaagagagagaatct
tgtaaccctcaggactgtgtccctgaagttgatgaaaactgcaaggacaagtactacaac
tgcaatgtggtggtccaggcgcgcctctgtgtctacaactactacaagactgcctgctgc
gcctcttgcacccgagtggccaacagacacacaggctttctggggagccgataa

DBGET integrated database retrieval system