KEGG   Rattus norvegicus (rat): 315731Help
Entry
315731            CDS       T01003                                 

Gene name
Larp6, RGD1308414
Definition
(RefSeq) La ribonucleoprotein domain family, member 6
  KO
K18733  la-related protein 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    315731 (Larp6)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     315731 (Larp6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: La SUZ-C Ribosomal_L6e
Motif
Other DBs
NCBI-GeneID: 315731
NCBI-ProteinID: NP_001101624
RGD: 1308414
Ensembl: ENSRNOG00000012438
UniProt: D3ZCR5
Position
8q24
AA seq 492 aa AA seqDB search
MAQLGEQTLPGPETTVQIRVAIQEAEDVEDLEEDDEGTSARAAGDTARYLSPGWGSASEE
EPSRGHSSATTSGGENDREDLEPEWKPPDEELIRKLVDQIEFYFSDENLEKDAFLLKHVR
RNKLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVTLELNEDHRKVRRTTPVPLFPNEN
LPSKMLLVYDLHLSPKLWSLATPPKNGRVQEKVMEYLLKLFGTFGVISSVRILKPGRELP
PDIRRISSRYSQVGTQECAIVEFEEVDAAIKAHEFMATESQGKENMKAVLIGMRPPKKKP
LKDKNHEDEPAAGTRLSRSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHVASNK
LSPSGHQNIFLSPNASPCSSPWSSPLAQRKGVSRKSPLAEEGRLNFSTSPEIFRKCMDYS
SDSSITPSGSPWVRRRRQAEMGTQEKSPGASPLLSRKMQTADGLPVGVLRLPRGPDDTRG
FHGGHERGRACI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctcggcgaacagactctgccagggcccgagaccacggtgcagatccgtgtc
gccatccaggaggccgaggatgtggaggatctggaggaggacgacgaggggacatcggca
cgggcagcgggggacacagcccggtacctcagtcctggctggggcagcgccagcgaggag
gagccgagccgcgggcacagtagtgccacgacaagtgggggtgagaatgaccgcgaggat
ctggagccagagtggaagcctccggacgaggagcttatcaggaagctggtggatcagatt
gagttctacttttccgatgagaatctggagaaggacgcctttctgctcaagcatgtgcgg
aggaacaagctgggctatgtgagcgtcaagctgctcacctccttcaagaaggtgaaacac
ctcacacgggactggaggaccacagcacacgccttgaagtattcggtcaccctggagttg
aatgaggaccaccggaaggttaggaggaccacccccgtgccgctgttccccaatgagaac
ctccccagcaagatgctgctggtatatgatctccacctgtcccctaagctatggtccctg
gccacacctccgaagaacggaagggtgcaggagaaggtgatggaatatctgctcaagctc
tttgggacttttggagtcatctcatcggtgcggatcctaaaacctgggagggagctgccc
cctgacatccggaggatcagcagccgctacagccaggtggggacccaagaatgtgccatt
gtggagttcgaggaggtggacgcggccatcaaagcccacgaattcatggccactgaatct
cagggcaaagagaacatgaaggctgtcctgattgggatgagaccgcccaaaaagaaaccc
ctcaaagataagaaccatgaggatgagcccgcagcgggtacccgcctaagcagatccctg
aacaagagagtggaggagcttcagtacatgggggatgagtcttccgccaacagttcctct
gaccctgagagcaaccccacctctcccatggctggccggcggcacgtggccagcaacaag
ctcagcccttctggccaccagaacattttcctgagcccgaatgcctccccgtgttcaagc
ccgtggagcagcccgttggcacaacgcaagggcgtctccagaaaatccccactggctgaa
gaaggcagactgaacttcagcacgagccccgagatcttccgaaagtgcatggactattct
tccgacagcagcatcactccctcgggcagcccctgggttcgcagaagacgccaagcagag
atggggactcaggagaaaagtccaggggcaagtcccctgctgtctcggaagatgcagaca
gcagatgggttaccggtgggggtgctgaggctgcccagaggccctgacgacaccaggggt
ttccacgggggacacgagagaggcagagcttgtatataa

DBGET integrated database retrieval system