KEGG   Rattus norvegicus (rat): 315870Help
Entry
315870            CDS       T01003                                 

Gene name
Tbx18
Definition
(RefSeq) T-box18
  KO
K10183  T-box protein 18
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    315870 (Tbx18)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   T-box
    315870 (Tbx18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 315870
NCBI-ProteinID: NP_001101643
RGD: 1309856
Ensembl: ENSRNOG00000010685
UniProt: D4A1V6
Position
8q31
AA seq 612 aa AA seqDB search
MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLATEEAAGAVDDAGCSRGGG
AREHRCTEADEDPAPPPPAAGSASGPARSCTDAERSCASRGPAGSCEDGFLQGASPLASP
GGSPKGSPVPGLARPGTPLPAPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRV
KISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGET
WMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHIIRKDCGDDLSPIKPVPSGEGVK
AFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRT
LTFEDIPGIPKQGNTSSSALLPGTGNGVPAAHPHLLSGSSCSSPAFHLGPNTSQLCSMAP
ADYSACARSGLALNRYSTSLAETYNRLTNQSSETFAPPRTPSYVSVSSPSVNMSMGGTDG
DTFSCPQTSLSMQISGMSPQLQYIIPSPSSNAFAANQTHQGSYNTFRLHSPCALYGYNFS
TSPKLAASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLGSGNQQSFFDSRTLGSL
TLSSSQVSAHMV
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagcggaggggctcaccgtgcagcatgctaagcctcaaggcgcatgccttc
tcggtggaggcactgatcggcgccgaaaagcagcaacagcttcaaaagaagcggagaaag
ctggccacggaagaggcggccggggcggtggacgacgcaggctgcagccgtggcggaggc
gcgagagaacaccgctgcaccgaggccgacgaagacccggctcccccgccgcccgcagcc
gggtcggcgtccgggccggcgcggagctgcacggacgccgaacggagctgtgcttcccgc
ggacccgcgggcagctgtgaggacggtttcttgcagggcgcttccccgctggcgtccccg
ggaggttccccgaaagggtctccggtacctggcctggcacggccggggaccccgctgccc
gcgccacaggccccaagagtggatctgcaaggagcagaactctggaaacgctttcacgaa
ataggcaccgagatgatcatcaccaaagccggcaggcgcatgtttccagcgatgcgagtg
aagatctccgggttagatcctcaccaacaatattacattgccatggatattgtgcccgtg
gacaacaaaagatacagatatgtttaccacagctctaaatggatggtggcaggaaatgct
gattccccggtgccaccccgagtatacattcatccagactcaccggcctctggggagact
tggatgagacaagtgatcagcttcgacaagctgaaacttaccaacaacgaactggatgac
caaggccatatcattcttcattctatgcacaaataccaaccgcgagtgcacatcatccgt
aaagactgcggggacgatctgtcccccatcaagcccgttccctcgggagagggagtgaag
gcgttctcctttccagaaacagtcttcacaactgtcactgcctatcagaatcagcagatt
actcgcctgaagatagacaggaatccatttgccaaaggcttccgagactctgggaggaac
agaatgggtttggaagctctggtggagtcatatgcattctggaggccatcactacgaact
ctcacctttgaagatattcctggaatcccaaagcaaggcaacacaagttcttcagctcta
ctcccaggtactgggaatggcgttcctgctgcgcaccctcacctgctgtctggctcctcc
tgttcctctcctgccttccatctggggcccaacaccagccagctgtgtagtatggctccc
gctgactattctgcctgcgcccggtcaggccttgctctcaaccgatacagcacgtccttg
gcagagacctacaacaggcttaccaaccagagcagcgagacctttgccccacccaggact
ccctcctatgtgagtgtgagcagcccctctgtgaacatgtccatgggcggcacggacggg
gacaccttcagctgcccgcagaccagcctgtccatgcagatttcaggaatgtcccctcaa
ctgcagtacatcatcccgtcaccatccagcaatgcctttgctgctaaccagacccatcag
ggttcctacaacactttccgattgcacagtccctgtgccttgtatggatataacttctcc
acatcccccaaactggctgccagtcctgagaaaattgtctcttcccaaggaagtttcttg
gggtcgtcaccgagtgggaccatgacggatcggcagatgttgcccccggtggaaggagtg
cacctgctcggcagtgggaaccagcagagtttctttgactccaggaccctaggaagcttg
actctgtcatcttctcaagtgtctgcgcatatggtctga

DBGET integrated database retrieval system