KEGG   Rattus norvegicus (rat): 315911
Entry
315911            CDS       T01003                                 

Gene name
Rnf128, RGD1566282
Definition
(RefSeq) ring finger protein 128, E3 ubiquitin protein ligase
  KO
K10629  E3 ubiquitin-protein ligase RNF128 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    315911 (Rnf128)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     315911 (Rnf128)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    315911 (Rnf128)
SSDB
Motif
Pfam: zf-RING_2 zf-RING_11 zf-C3HC4_2 zf-rbx1 zf-C3HC4 zf-RING_5 PA zf-RING_UBOX zf-C3HC4_3 zf-ANAPC11 zf-C3H2C3 zinc_ribbon_16 Prok-RING_4 LapA_dom PHD CcmD
Other DBs
NCBI-GeneID: 315911
NCBI-ProteinID: NP_001166820
RGD: 1566282
Ensembl: ENSRNOG00000055721
UniProt: B2RZ84
Position
Xq32
AA seq 428 aa
MGPPPGIGVYCRGGCGAARLLAWCFLLALSPHAPGSRGAEAVWTAYLNVSWRVPHPGVNR
TVWELSEEGVYGQDSPLEPVSGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALI
QRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAGDIVAIMIGNLKGTKIL
QSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFIITAATVGYFIFYSARRLRNARAQ
SRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCAVCIELYKPNDVVRILTCNHIFH
KTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEASNTASPHEEDNRSE
TASSGYASVQGADEPPLEEHAQSANENLQLVNHEANSVAVDVVPHVDNPTFEEDETPDQE
MAVREVKS
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggggccgcctcccgggatcggggtctactgccgcggcggctgcggagctgcccggctg
ctggcttggtgcttccttctagctctgagtccgcacgcgcccggttcccggggagccgaa
gctgtgtggaccgcgtacctcaacgtgtcctggcgggttccgcaccccggagtgaaccgc
acggtgtgggagctgagcgaggagggcgtgtacggccaggactcgccgctggagcccgtc
tccggggtcctggtaccgcccgacgggcccggggcgctcaacgcctgtaacccgcacacc
aatttcacggtgcccactgtttgggggagcacggtgcaagtatcttggttggccctcatc
caacgcggcggaggctgcaccttcgcggacaagatccatctggcttatgagagaggggct
tctggagccgtcatctttaacttccccgggacccgcaatgaggtcattcccatgtctcac
ccgggtgcaggagacattgttgcgatcatgattggcaatctgaaaggaacaaaaattcta
cagtccattcaaagaggcatccaagtaacaatggtcatcgaagtaggcaaaaaacatggc
ccttgggtgaatcattattcaattttcttcgtttccgtgtccttttttattattacagca
gcaactgtgggctattttatcttttactctgctcgaagattacggaatgcaagagctcaa
agtaggaagcagaggcagttaaaggcagatgctaaaaaagctattggcaggcttcagctg
cgcaccttgaaacaaggagacaaggaaattggccctgatggagatagctgtgctgtgtgc
atcgagctctataagcccaatgatgtggtgcgcatcctaacctgcaatcatattttccat
aagacgtgtgtggacccatggcttttagagcacaggacttgccccatgtgcaagtgtgac
attctcaaagctctgggaattgaggtggatgttgaggatggatcagtgtctttacaagtt
cctgtttctaatgaagcatctaatactgcctctccccacgaagaggacaaccgcagtgag
actgcttcatctggatatgcttcagtacagggagcagatgagccacctctggaggagcat
gcgcaatcagcaaatgaaaatctacagctggtcaaccatgaagcaaattctgtggctgtg
gatgttgttccccatgttgacaacccaacctttgaggaagatgaaactcctgatcaagag
atggctgttcgagaagttaaatcctaa

DBGET integrated database retrieval system