KEGG   Rattus norvegicus (rat): 315912Help
Entry
315912            CDS       T01003                                 

Gene name
Tbc1d8b, RGD1563084
Definition
(RefSeq) TBC1 domain family member 8B
  KO
K19951  TBC1 domain family member 8/9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    315912 (Tbc1d8b)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    315912 (Tbc1d8b)
 Endosome - Golgi transport
  Rab GTPases and associated proteins
    315912 (Tbc1d8b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC GRAM EF-hand_1
Motif
Other DBs
NCBI-GeneID: 315912
NCBI-ProteinID: XP_003749528
RGD: 1563084
Ensembl: ENSRNOG00000054011
UniProt: A0A0G2K9M5
Position
Xq32
AA seq 1118 aa AA seqDB search
MWLKPEEVLLKNALKLWLMERSNEYFVLQRRRGYGEEGGGGLTGLLVGTLDSVLDSTAKV
APFRILHQTPDSQVYLSIACGANREEITKHWDWLEQNIMKTLSVFDSNEDITNFVQGKIR
GLIAEEGKQSFAKEDDPEKFREALLKFEKSFGLPEQEKLVTYYSCSYWRGRVPCQGWLYL
STNFLSFYSFLLGSEIKLIISWDAISKLEKTSSVIVAESIHVCSQGENHYFSMFLHINET
YLLMEQLTNYAIKRLFDKETFDNDPVLDDPLQITKRGLEYRAHSEQFKAFFRLPKEETLK
EVHECFLWVPFSHFSTHGKMCISENYICFASQDGNLCSVIIPLREVLAVDKTDDSSRSVI
ISIKGKTAFRFNEVKDFEQLVAKLRLKCRAASTQDDGSTEVAISSDSTGLSENFEEQPLT
FPKECSKTVNTEALMTVFHPQNLENLDSKMLKEKMKEQSWNILFSECGRGVSMFRTKKTR
DLVVRGIPETLRGELWMLFSGAVNDMAANPGYYAEVVEQSLGTSNLATEEIERDLRRSLP
EHPAFQSDTGISALRRVLTAYAYRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCER
MLPDYFNRRIIGALVDQAVFEELIRDHLPQLTDHMTDMTFFSSVSLSWFLTLFISVLPIE
SAVNVVDCFFYDGIKAILQLGLAILDYNLDKLLTCKDDAEAVTALNRFFDNVINKDSPLP
SNVQQGSNINDGKSNHAKVDITDLIRESNEKYGSIRYEDIHSMRCRNRLYVIQTLEETTK
QNVLRVVSQDVKMSLQELDELYVIFKKELFISCYWYLSCPGLKHHDPSLSYLEQYQIDCQ
QFRVLFHLLCPWAHSANRDSLALWTFRLLDENSDCLINFKEFSSAIDIMYNGSFTEKLKL
LFKLHIPPAYTEVISKTSSKGDELSTEELLYFSQLQVSKPADGKETELGRKSPEKGKGKI
DIQAYLSQWQDELLKKEENIKDLPRMNQSQFIQFSKTLYNLFHEDPEEEALYQAIAIVTN
LLLRMEEVGRKLHSPASSAKGLSSVACDSGPSEGNTESSVKKDPSSPREEHQWSFAFEQI
LASLLNEPALVRFFERPLDLKAKLEKAKSSQLRSRTKM
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgaagcccgaggaagtgttgttgaaaaatgcgctgaagctgtggctgatggaa
agatccaacgagtactttgtcctgcaaaggcggcgaggctacggggaagaaggcggagga
ggacttacaggtcttttggttgggactcttgattccgtcttagactctactgctaaggta
gctccgtttcgcatcctacaccagacaccagattctcaagtgtacttgtcaattgcatgt
ggagccaacagagaagaaataacaaaacattgggactggttggaacaaaatatcatgaag
actttatctgtgttcgattcaaatgaagatattactaattttgtacaaggcaaaataaga
ggactaattgctgaagagggaaaacaatcttttgctaaagaagatgatcctgagaaattt
cgagaagcccttttgaaatttgaaaaatcttttggtttaccagagcaggagaaactagta
acttattattcttgcagttactggagaggacgggttccttgtcagggttggctctatcta
agtaccaactttctgagcttctattctttcttgctaggatcagaaattaaactcataatc
tcctgggatgcaatctcaaaacttgaaaagacttcaagtgttatagtagcagagagtatt
cacgtatgttctcaaggagagaaccactatttctcaatgtttttacacatcaatgaaacc
taccttcttatggaacagctgacaaactatgccataaagagactttttgataaggaaaca
tttgataatgacccagtccttgatgatcctctacagattaccaaaagaggtttggaatat
cgagcccacagtgagcaattcaaagccttttttaggctacccaaagaagaaactttgaaa
gaagtacatgaatgttttttatgggtaccattcagccacttcagtactcatggaaaaatg
tgcatttcagaaaactatatttgctttgctagccaggatgggaatctatgtagtgttatc
attccattacgagaggttttagctgtagataaaactgatgactccagcagatccgtcatc
attagcatcaaaggaaaaacagcttttcgtttcaatgaggttaaagactttgagcaactg
gtggcaaagctcaggctcaagtgccgggcagcttcaactcaagatgatggtagcacagag
gttgctattagttctgactctacaggcctatctgagaattttgaggaacaacctttgaca
tttccgaaggaatgcagtaaaactgtgaacactgaagccttaatgacagtatttcaccct
caaaatttggaaaatcttgattctaaaatgttaaaggaaaagatgaaggaacaatcatgg
aacatcttattttcagaatgtggtcgtggggttagcatgttccggacaaaaaagactcga
gacctggttgtaagagggattccagagactttaagaggggagctctggatgcttttctca
ggtgctgttaatgacatggcagctaaccctggctattatgctgaagtggttgaacaatcc
ttagggacctccaacctggcaactgaagaaattgagcgtgatttgcgtcgctccctgcct
gaacacccagcatttcagagtgatactggcatatctgctctgaggcgggtactgacagct
tatgcatataggaatcccaaaataggatactgccaggcaatgaacattttgacttcagta
ttgctcctatatgcaaaagaagaagaagctttttggcttctggttgctgtatgtgaacga
atgttgccagattattttaatcgtcgaatcattggtgccttggtggatcaggcagtgttt
gaagaactaatcagggatcaccttcctcagctgacagaccacatgaccgacatgactttc
ttttcctcagtttctctctcgtggttcctcacgcttttcattagtgtgcttcctattgaa
agtgcagtgaatgtggtggactgtttcttctatgacggaatcaaagccattttacaactg
ggattggcaatactggactataatttagacaaacttctgacatgtaaagatgacgctgaa
gctgtgacagcactaaacaggttctttgacaatgtcattaataaggatagcccattgcct
tcaaatgttcagcagggttcaaatatcaatgatggaaaaagcaatcatgctaaagtggat
attacagatttgattagagagtccaatgagaaatatggtagtattcgctatgaagatata
catagcatgcgctgtcgaaataggttgtatgtgatacagaccctggaggaaacaacaaag
cagaatgtgttgcgtgttgtatcacaagatgtgaaaatgagccttcaggaattggatgaa
ctttatgtcatttttaagaaagagctgttcatatcttgttattggtatttgagttgtcca
ggactgaagcatcatgaccccagcctgtcatatttggaacaatatcagattgactgccag
caattcagagtattgtttcacttgttgtgtccctgggctcattctgcaaacagagactct
ctagctttgtggacattcagattgttggatgagaactctgattgccttataaacttcaaa
gaattctcctctgcaatcgatataatgtacaatggaagttttactgagaagctcaagctg
ctttttaagctgcatattcctccagcttatactgaagtgatatctaagacttcttcaaaa
ggtgatgagctttcaacagaagaattactttatttcagtcagctccaagtttctaagcct
gcagatgggaaggaaacagaattgggaagaaaaagccctgagaaaggcaaaggaaaaatt
gatattcaagcctatttaagtcaatggcaagatgaacttctcaaaaaagaagagaacatt
aaagatttaccaagaatgaatcagtcacaatttattcagttttcaaagaccctgtataat
ttatttcatgaggaccccgaagaagaggcgctatatcaagccattgctattgtaaccaac
cttcttctcaggatggaagaagttggaaggaaactccatagcccggcgtcatcagccaaa
ggactgtccagtgtagcctgtgattctggacccagtgagggaaacacagagagcagtgtg
aagaaagatccttcctctcccagagaagaacatcagtggtcctttgcattcgagcagatt
cttgcttccctgttaaacgaaccggccctggtgaggttttttgagagacccttagattta
aaagccaagctagaaaaggcgaaaagctcccagttaaggtctagaaccaagatgtaa

DBGET integrated database retrieval system