KEGG   Rattus norvegicus (rat): 315953
Entry
315953            CDS       T01003                                 

Gene name
Cldn18
Definition
(RefSeq) claudin 18
  KO
K06087  claudin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    315953 (Cldn18)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    315953 (Cldn18)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    315953 (Cldn18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    315953 (Cldn18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    315953 (Cldn18)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   315953 (Cldn18)
  Exosomal proteins of colorectal cancer cells
   315953 (Cldn18)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin
Other DBs
NCBI-GeneID: 315953
NCBI-ProteinID: NP_001014118
RGD: 1359696
Ensembl: ENSRNOG00000030386
UniProt: Q5I0E5
Position
8q31
AA seq 261 aa
MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVQQSSGF
TECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLT
SGIMFIISGVCAIIGVSVFANMLVTNFWMSTANMYSGMGGMVQTVQTRYTFGAALFVGWI
AGGLTLIGGVMMCIACRGLTPDDRNFKAVSYHASGQNVAYKPGGFKASTGFGSNARNKKI
YDGGARTEDDEQSHPTKYDYV
NT seq 786 nt   +upstreamnt  +downstreamnt
atggccaccaccacgtgccaggtggtagggctcctcctgtccctcctgggtctggccggc
tgcatagccgccactggaatggacatgtggagcactcaggacctgtatgataacccagtc
acctccgtgttccagtatgaagggctctggaggagttgcgtgcaacagagctcggggttc
actgagtgccggccatacttcaccatcctgggccttccagccatgctgcaagcagtgcga
gccctgatgatcgtgggcattgttctgggggtcatcggcatcctggtgtccatcttcgcc
ctgaagtgcattcgcattggcagcatggatgactctgccaaggccaagatgactctgact
tctgggattatgttcatcatctcaggagtctgtgcaatcattggtgtgtctgtgtttgcc
aacatgctggtaaccaacttctggatgtccacggccaacatgtacagcggcatgggtggg
atggtgcagaccgttcagaccaggtacacttttggtgcagctctgtttgtgggctggatc
gctggaggcctcacactaattggaggtgtgatgatgtgcattgcttgccgtggcctgact
cctgatgaccgcaacttcaaagccgtgtcctaccacgcttctggccaaaatgttgcctat
aagcctggaggctttaaggccagcactggctttgggtccaacgccagaaacaagaagata
tatgatgggggtgcccgcacagaagacgatgaacaatctcatcctaccaagtacgactat
gtgtag

DBGET integrated database retrieval system