KEGG   Rattus norvegicus (rat): 315957
Entry
315957            CDS       T01003                                 

Gene name
Slc35g2, Tmem22
Definition
(RefSeq) solute carrier family 35, member G2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-GeneID: 315957
NCBI-ProteinID: NP_001012126
RGD: 1306109
Ensembl: ENSRNOG00000015370
UniProt: Q5M7A3
Position
8q31
AA seq 412 aa
MDTSPSKKYPIKKRVKIHPNTVMVKYTSHYPQPGEDGYEEINEDYGRFMEENPKKSLLSE
MRRKGRTLFGTMDTQPPRSEDPRASSRGQFQSFAEKNIFQSRKMWLVLFGSALAHGCVAL
ITRLVSDRSKVPSLELIFIRSVLQVLSVIVVCYYQEAPFGPSGYRLRLFLYGVCNVISIT
CAYTSFSIVPPSNGTTMWRATTTVFSAVLAFLLVDEKMAYVDMATVVCSILGVCLVMIPN
IADEDNSLLNVWKEAFGYTMTVMAGLTTALSMIVYRSIREKISMWTALFTFGWTGTIWGL
STMFVLQEPIIPLDGETWSYLIAICICSTVAFLGVYYALDKFHPALVSTVQHLEIVVAMV
LQLLVLHIFPSVYDVFGGVIIMISVFVLAGYKLYWRNVRREDYQEILDSPIK
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggatacttctccatccaaaaaatacccaattaaaaaacgggtgaaaatacatcccaat
acagtcatggtgaaatatacctctcattatccccaacccggggaggatgggtatgaagaa
atcaacgaagactatggtagatttatggaagaaaacccaaagaaaagtctgctgagtgaa
atgagaagaaaaggaagaactctgtttggaaccatggacactcagcctccacgatcagaa
gacccaagagccagcagcaggggacagttccagagctttgcagaaaagaacatttttcag
tcccgaaaaatgtggctagtgctgtttgggtctgcactggcgcatggatgtgtggctctc
atcacgaggcttgtttccgaccgttctaaagttccgtccttagaactgatttttatccgg
tctgtcttgcaggtcttatccgtgatagttgtgtgttattaccaggaagctccctttggg
cccagcggatacagattacgacttttcttgtacggtgtgtgcaacgttatttccatcacc
tgcgcttacacctccttttcaatagttcctcccagcaatggcaccacgatgtggagagcc
accaccaccgttttcagtgctgttctagcctttcttcttgtagatgagaaaatggcatat
gttgacatggctacagtggtctgcagcatcctgggtgtttgtcttgtcatgatccccaac
attgctgatgaggacaattctctgttaaatgtctggaaggaagcctttgggtatacaatg
actgtgatggctgggctgaccactgctctttctatgatagtgtacagatccatcagggag
aagatcagcatgtggaccgcactgtttacctttggttggactggaacaatctgggggtta
tctactatgtttgtccttcaagaacccatcattcctttagatggagaaacatggagctat
ctcattgctatatgcatctgttctactgtagcattcttaggcgtttattacgccttggac
aaattccacccagctttggtcagcacagtacaacatctggagattgtggtagctatggtc
ttacagcttctagtgttacacatatttcctagtgtttatgatgtttttggaggggtgatc
atcatgattagtgtatttgtccttgctggctataaactttactggaggaatgtaaggagg
gaagattatcaggaaatactggactctcccattaaatga

DBGET integrated database retrieval system