KEGG   Rattus norvegicus (rat): 315958Help
Entry
315958            CDS       T01003                                 

Gene name
Stag1
Definition
(RefSeq) stromal antigen 1
  KO
K06671  cohesin complex subunit SA-1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    315958 (Stag1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    315958 (Stag1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Cohesin complex
    315958 (Stag1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAG RFX5_DNA_bdg Cnd1
Motif
Other DBs
NCBI-GeneID: 315958
NCBI-ProteinID: NP_001101649
RGD: 1310744
Ensembl: ENSRNOG00000015389
UniProt: D4A3Q2
Position
8q31
AA seq 1122 aa AA seqDB search
MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPSTNKKPRKSPGEKSRI
EAGIRGVGRGRANGHPQQNGEGDPVTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDL
INFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCE
FIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNL
SIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRY
RDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTN
RELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV
YSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEH
AAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAH
PPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFD
LEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEACSKTYSILCSEEYTIQNRVDIARSQ
LIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLKRLTSFHNAHDLTKWDLFGNCYRLL
KTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGSPSKYYNDYGDIIKETLSKTRQIDK
IQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFALTFGLDQIKTREAVAT
LHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMME
RREDVWLPLISYRNSLVTGGEDDRMSVNSGSSSSKTSSVRSKKGRPPLHRKRAEDESLDN
TWLNRTDTMIQTPGPLPTPQLTSTVLRENSRPMGEQIQEPESEHGSEPDFLHNPQMQISW
LGQPKLEDLNRKDRTGMNYMKVRAGVRHAVRGLMEEDAEPIFEDVMMSSRSQLEDMNEEF
EDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgattacttcagagttaccagtgttacaggattcaactaatgaaactactgcccattct
gatgctggcagcgaacttgaagaaacagaggtcaaaggaaagagaaaaaggggtcgtcct
ggccggcctccatcaacaaataagaaacctcgaaaatctccaggagaaaagagcagaatt
gaagctggaattagaggagtgggtcgcggaagagctaatgggcaccctcaacagaacggc
gaaggggatcccgtcaccttatttgaggtggtgaagctggggaagagtgcaatgcagtct
gtggtggatgactggattgaatcatataaacaagaccgggacatcgcacttctggattta
atcaacttttttatccagtgttcaggatgtcgaggtactgtcagaatagagatgtttcga
aatatgcagaacgcagaaataatcagaaaaatgactgaagaatttgatgaggacagtggt
gactacccccttaccatgcctggtcctcagtggaaaaaatttcgttccaatttttgtgaa
tttattggagtcctgattcgacagtgtcaatatagcataatttatgatgaatatatgatg
gacaccgtaatttcccttttgactggtttgtcagactcccaggtcagagcttttaggcat
acaagtacccttgctgcaatgaagctgatgactgctctggtgaatgttgccttaaacctc
agtattcatcaggataatacacagaggcaatacgaagccgagagaaataaaatgattggg
aagagagccaatgaaaggctggagttactacttcagaaacgtaaagagctacaagaaaat
caagatgaaattgaaaatatgatgaactctatttttaagggtatatttgttcatagatac
cgtgatgcaattgctgaaattcgagccatctgtattgaagaaattggagtatggatgaaa
atgtatagcgatgccttcctcaatgacagttacctgaaatatgtaggatggactcttcat
gataggcaaggtgaagtcagactgaagtgtttgaaagctctacaaagcctgtataccaat
agagaattattccccaaattggagctgtttactaatcgattcaaggatcgcattgtatca
atgactcttgacaaagaatatgatgttgctgtggaagccatccggttggttactctgata
cttcatggaagtgaagaagctctttccaatgaagactgtgaaaacgtctaccatttggtg
tactcagcacatcgccctgttgctgtggcagctggagagtttctgcacaaaaagctgttt
agcagacatgacccacaagctgaggaagcattagcaaagagaagaggaagaaacagtcca
aatgggaacctcattaggatgcttgttcttttctttcttgaaagtgagttacatgaacat
gcagcctacttggtggacagcttgtgggagagctctcaagaactgttgaaagactgggaa
tgtatgacagagttactattagaagaacctgttcaaggagaggaagccatgtctgaccgt
caggagagcgctcttatagagctaatggtctgtacaattcgtcaagcagctgaggcacat
cctccagtgggaaggggaaccggcaagagagtgctaacagccaaagaaaggaaaactcaa
attgatgatagaaataaattaactgaacattttatcattacacttcctatgttactatca
aagtattctgcagatgcagagaaggtagcgaacttgctgcagattccacagtattttgat
ctggaaatctacagcacaggtcggatggaaaagcacctggatgctttattaaaacagatt
aagtttgttgtagagaaacatgtagagtcagatgtcctagaagcctgcagtaaaacctac
agcattttatgcagtgaagagtacaccattcaaaatcgagtcgatattgctcggagccag
ctcattgatgaatttgtagatcgattcaatcattctgtagaagacctattgcaagagggt
gaagaagctgatgatgatgatatctacaatgttctttccaccttaaagcgtttaacttct
tttcacaatgctcatgatctcactaaatgggatctgtttggtaattgctacagactattg
aagactggaattgaacatggagctatgccagaacagatagtcgtacaagcactgcagtgt
tcccattactcaattctttggcagctggtgaaaattactgatggttctccttccaaatat
tacaatgactatggtgatattattaaggaaaccctgagtaagaccaggcagattgataag
attcagtgtgctaagactctcattctcagtctacaacagttgtttaatgaacttgttcaa
gaacaaggtcctaatctggataggacatcggcccatgtcagtggaattaaagaactggca
cgtcgttttgcccttacatttggattggaccagatcaagacccgagaagcagttgccaca
cttcacaaggatggaatagagtttgcctttaaataccagaatcagaaaggacaagagtat
ccacctcctaatctggcttttcttgaagtactaagtgaattttcttctaaactccttcga
caggacaagaaaactgtccattcctatcttgaaaaattcctcactgagcagatgatggaa
aggagggaggatgtatggcttccactcatctcgtatagaaattcgttagtcactgggggt
gaagacgacagaatgtctgtgaacagtggaagtagcagcagtaaaacttcctcagtgcgc
agtaagaaaggaagacccccactgcacagaaaacgagcagaagatgaaagtctggataac
acatggctaaataggactgacacaatgattcagactcctggacccttgccaaccccacag
ctcacctccactgtacttagagagaacagccgtcccatgggagagcagattcaggagcct
gagtctgagcatggttctgaaccagactttttacacaatccccagatgcagatctcttgg
ttaggccagccgaagttagaagacttgaatcggaaggacagaacaggaatgaactacatg
aaagtgagagctggagtaaggcatgctgttcggggtctaatggaggaagatgctgagccc
atctttgaagatgtgatgatgtcatcacggagccagttagaagacatgaatgaagaattt
gaagacaccatggttattgatttgcccccatcaagaaatcggcgagagcgagctgagcta
aggccagacttctttgactctgcagctatcatagaagatgattcaggatttggaatgcct
atgttctga

DBGET integrated database retrieval system