KEGG   Rattus norvegicus (rat): 315994
Entry
315994            CDS       T01003                                 

Gene name
Mapkapk3, MAPKAP-K3, MK-3
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 3
  KO
K04444  mitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04370  VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    315994 (Mapkapk3)
   04370 VEGF signaling pathway
    315994 (Mapkapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    315994 (Mapkapk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     315994 (Mapkapk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   315994 (Mapkapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 315994
NCBI-ProteinID: NP_001012127
RGD: 1304980
Ensembl: ENSRNOG00000014832
UniProt: Q66H84
Position
8q32
AA seq 384 aa
MDGETAGEKGSLVPQPGALGAPALGGAPAPGVRREPKKYAVTDDYQLSKQVLGLGVNGKV
LECYHRRSGQKCALKLLYDSPKARQEVDHHWQASGGPHIVRILDVYENMHHGKRCLLIVM
ECMEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSQNIAHRDVKPENLLYTSKE
KDAVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCG
FPPFYSNTGQAISPGMKRRIRLGQYGFPKPEWADVSEDAKQLIRLLLKTDPTERLTIMQF
MNHPWINQSMEVPQTPLHTARVLEEDKDHWDDVKEEMTSALATMRVDYDQVKIKDLKTSN
NRLLNKRRKKQGGSSSASPGCNNQ
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggatggcgagacggcgggggagaaggggagtcttgtgccccagccaggtgcgctcggt
gcgcccgccttgggcggtgctccggccccaggtgtgcgacgggaacccaagaagtacgcg
gtgactgatgactaccagttgtccaagcaagtgctgggtctgggtgtgaacggcaaggta
ctagagtgctaccatcggcgctctgggcagaagtgtgccttgaagctcctgtatgacagc
cccaaggcccggcaggaggtggaccaccactggcaggcctcaggcggcccccacattgtg
cgcatcctggacgtgtacgagaacatgcatcacggcaagcgctgcctcctcatcgtcatg
gaatgcatggagggtggtgagctgttcagcaggattcaggagcgcggtgatcaggctttc
actgagagagaggccgcagagataatgcgggacattggcactgccatccagttcttgcac
agccagaacattgcccaccgagatgtcaagcctgaaaacctactctatacatccaaggag
aaggatgctgtacttaaactcactgattttggctttgccaaggaaaccacccaaaatgcc
ctccagacaccctgttacactccctattatgtggctcctgaggtcctgggtccagagaag
tatgacaagtcgtgcgatatgtggtccctgggggtcatcatgtacatccttttgtgtgga
ttcccacccttctactccaacacgggccaggccatctctccaggaatgaagagaaggatt
cgcttgggccagtatggcttccctaaacctgaatgggcagacgtctctgaggatgccaag
cagctaatccgtctgctcctgaagacagatcccaccgagaggctgaccatcatgcagttt
atgaaccatccttggatcaatcaatcgatggaggtcccacagaccccactccatacagcc
cgagtgctggaggaagacaaagaccactgggatgacgtcaaggaagagatgaccagtgcc
ctggccacgatgagggtagactacgaccaggtgaaaatcaaggacctgaagacctctaac
aaccgactcctcaacaagcggaggaaaaagcaggggggcagctcctcagcctcaccggga
tgcaacaaccagtaa

DBGET integrated database retrieval system