KEGG   Rattus norvegicus (rat): 316009
Entry
316009            CDS       T01003                                 

Gene name
Plxnb1
Definition
(RefSeq) plexin B1
  KO
K06821  plexin B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    316009 (Plxnb1)
SSDB
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI
Other DBs
NCBI-GeneID: 316009
NCBI-ProteinID: XP_006226632
RGD: 1310564
Ensembl: ENSRNOG00000029510
UniProt: D3ZDX5
Position
8q32
AA seq 2121 aa
MSVLGPVLLQVFWAGCVLTLQFPVPAAFTANGTHLQHLARDPTTGTLYVGATNFLFQLSP
GLQLEAVVSTGPVNDSRDCLPPVIPDECPQAQPTNNPNQLLLVSPEALVVCGSVHQGICE
LRSLGQIRQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALRPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFVRGTSAYFLFLRRDLKAP
SRAFRAYVSRVCLQDQHYYSYVELPLACQGGRYGLIQAAAVATSKEAARGEILFAAFSSV
APPTVDWPLSASTGASGTSVLCAFPLDEVDQLANDTRDACYTREGRAENGTKVADIAYDV
LSDCAQLPVDTPDAFPCGSDHTPSPMVSCVPLEATPILELPGVQLTAVAVTMEDGHTIAF
LGDSQGQLHRVYLGPGRSAAPYSKQSIQPGSAVNRDLTFDGTFEHLYVATQTTLVKVPVA
PCAQHLDCDSCLAHRDPYCGWCVLLGRCSRRSECSRAQGPEQWLWSFQSELGCLRVVAVS
PANISRGERREVFLSVPGLPSLWPEESYFCYFGDQQSPALLTSSGVMCPSPDPSEAPVLQ
RGADHISVNVELRFGAVVIANTSLSFYDCMAVTEFFPSAPCRACVSSRWGCNWCVWQQLC
THKASCDSGPMVASQQSPLLPLIPPARDVLTPFPLTVPRATATPTPNTFPAEPRAPSIAS
DVLPGAKPSRLSLWGPWAGPGPILSPTSTESPLHEKPLPPEPPTTPGTTVPAPADLGPLT
TPEDLLASYPFPSDAAAVSPTEPGPETLPSMVALDQPPGTAPATLFPGATGSMKPVLDWL
TKGGGELLEAEEWMGGDTPAFSTSTLLSGDGDSAEHEGPSAPLILLSSLDYQYDTPGLWE
LGEVNQRVSSCPCVENVQGSLLIPVHVKREVQLRGRNLWLFQDGPRSSECVLVLEGLEVA
VEAQVECEPPPDTWCHIKCQQHQFSYEASKPELQVGLFLRWAGGLRVDSADGLHVVLYDC
SVGHGDCSRCQTAMPQYDCVWCEGEHPRCVAREACNEAETVATQCPAPLIHSVEPLTGPI
DGGTRVTIRGSNLGQHVQDVLGMVRVAGVPCAVDVGEYDVSSSLVCITGSSGEEVTGAVA
VEVPGRGHGVSEFSFAYQDPKVLSIFPVHGPRAGGTHLTLHGSKLLTGRLEDIRVVVGDQ
PCHLLLEQQSEQLHCETSPNPVPAELPVMVWFGATERRLQHSQFKYTADPNITSVGPAKS
FFSGGREIWVRGQNLDVVQMPRIRVTVIPRVPQHGQGLGQKHHVVPEKIEEPCLVNSSHL
IMCRSPALPGPPQDPWVQVEFILDNMVFDFATLSPTPFSYEADPTLRSLNPEDPTTPFRH
KPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVEQPLPHHHALREA
PDALPEFTVQMGNLRFSLGHVQYDGESPVAFPVAAQVGLGVGVSLLALGVIVIVLIYRRK
SKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGIPFLDYKVYAER
VFFPGHQESPLHRDLGVPDSRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDR
AYVASLLTVALHGKLEYFTDILRTLLSDLVAQCVAKNPKLMLRRTETVVEKLLTNWMSIC
LYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNAL
LAVGPGAGEAQSVPVKVLDCDTISQAKEKMLDQLYKGVPLAQRPDSRTLDVEWRSGVAGH
LILSDEDVTSELEGLWRRLNTLQHYKVPDGATVALVPCLTKHILRENQDYVPGERTPMLE
DVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVD
DLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQ
FVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIPRYKQMVERYYA
DIRQTVPASDQEMNSVLAELSRNCSADLGARVALHELYKYINKYYDQIITALEEDGTAQK
MQLGYRLQQIAAAVENKVTDL
NT seq 6366 nt   +upstreamnt  +downstreamnt
atgtctgtcctcggcccagttcttctccaggtgttctgggctggctgtgtcctcaccctg
cagttccctgtaccagctgctttcactgccaatggcacacatctacaacacttggcgaga
gaccccaccacaggtaccctctatgtaggggccaccaacttcctgttccagttgagccct
gggttgcagctagaagctgtggtgtccacgggccctgtgaatgacagccgggattgcctg
ccacctgtgatacctgatgaatgtccccaagcccagcctactaacaaccctaaccagctg
ctcctggtgagcccagaggctctggtggtgtgtgggagcgtacaccagggcatctgtgag
ctacggagcctgggacagatcaggcaattgctgctacggccagagcgacctggggacacc
cagtatgtggctgcaaatgaccctgcggtcagcacagtggggctggtggcccagggatta
gcaggggaacccctcctgtttgtgggacggggatataccagcaggggcgtaggtggtgga
attcctcccattacaacccgagccttgcgaccaccggacccccaagctgctttctcttac
gaagaaacagccaagctggcagtgggccgcctctctgagtacagccaccacttcgtgagt
gccttcgtacgtgggaccagcgcatacttcctgttcttgaggcgagacctgaaggcccct
tctcgagctttccgtgcctacgtgtcccgagtgtgccttcaggaccagcattactactct
tatgtggaattgcccttggcctgccagggtggccgctatggtcttatccaggctgcagct
gtagccacatccaaggaggcggcccgtggggaaatactcttcgcagctttctcctcagta
gctcctcctactgtggattggcccctgtcagcatctactggggcatctggaacctctgtg
ctctgtgccttccccctggatgaggtagaccagcttgctaatgatactcgagatgcctgt
tacacccgggaaggccgtgctgagaatgggaccaaggtggctgacattgcctatgatgtc
ctttccgactgtgcacagctaccagtggacaccccggatgcttttccatgtggctcggac
cacacacccagtcccatggtcagctgcgtccctttggaagccacaccaattctggagctg
ccaggggttcagctaactgctgtggcagtcaccatggaggatggacatactattgctttc
ctgggtgacagtcaaggacagttgcatagggtctacttaggccctgggagaagtgctgcc
ccatattccaaacagagcatccagccggggtctgccgtgaacagagatcttacctttgat
ggtacctttgagcatctgtatgtagcaactcagactacacttgtgaaagttcctgtggcc
ccttgtgctcagcacctggattgcgactcttgccttgctcacagggacccttattgcgga
tggtgtgtgctcctgggcaggtgtagtcgccggtcggagtgctcaagggcccagggccca
gagcagtggctgtggagcttccagtcggaactaggctgtcttcgagtggtggccgtgagc
cctgccaacattagtcggggagagaggagggaggttttcctgtcggtgccaggcctgcca
tctctctggccagaggagtcatatttctgctactttggggaccaacagagtcctgctcta
ctgaccagttctggtgtgatgtgtccctccccagaccctagtgaggctccagtgctgcag
agaggagccgaccatatctccgtgaatgtggagctcaggtttggtgctgtggtgatcgcc
aacacctccctctcgttctatgactgcatggcggttaccgagtttttcccgtctgcaccg
tgccgggcctgtgtgagcagccgctggggctgtaactggtgtgtgtggcagcagctgtgt
acgcacaaggcctcgtgtgactctgggcctatggtggcaagccaacagagcccacttctc
cccctaatccctcctgcaagggacgtactcacccctttcccactcacagtccccagagcc
acagccactccaactcccaacaccttcccagcagagcctagggctccctccatagcctca
gatgtcctacccggggccaagccttcccggctcagcctctggggcccatgggcaggccct
ggccccatactttcccctacctccacagagtcacctctccatgagaagcccctccctcct
gagccccctaccacacctggaaccactgtccctgcccccgctgacctgggacccttgacc
acgcctgaggacctcttggcctcctacccattcccctcagatgcagctgcagtatccccc
acagagcctggccctgagactctgccttccatggtagctctggatcagccccctggcact
gctccagccacccttttcccaggggccactggctccatgaagccagttctggattggctc
accaaaggaggcggcgagctgctcgaggcggaggagtggatggggggtgacacgcccgcc
ttctccacttccacactcctctcaggtgatggcgactcagcagagcacgagggcccttct
gctcccctcatcctcctgtccagcctcgactaccagtacgacacccccgggctctgggag
ctgggagaggtgaatcagagggtgagctcctgcccctgtgtggagaacgtccaaggctcc
ttgctgataccggtccacgtgaagcgggaagtccagcttcgaggcaggaacctgtggctc
ttccaggacggcccaaggagcagtgagtgtgtgctggtgctggagggcctcgaggtggca
gtggaggctcaggtggagtgtgagccacctccagacacatggtgccacatcaagtgccag
cagcaccagttcagctatgaagcttcaaagccagaactccaagtgggactgttcctgcgc
tgggcgggtggtctgcgtgtggacagtgccgatgggctacatgtggtattgtatgactgc
tctgtgggacatggggactgcagccgctgccaaacggccatgcctcagtacgactgtgtg
tggtgcgagggggagcacccgcgctgtgtagcccgagaagcctgtaatgaagccgagacc
gtggctacccagtgccctgcacctctaattcactcggtggagccgctgactggacctata
gacggaggcacccgtgtcaccatcaggggctccaacctgggccagcatgtccaggacgtc
ctgggcatggtcagagtagcaggagtgccctgtgcggtcgatgttggcgagtacgacgtc
tccagtagtcttgtgtgcatcactggaagcagcggggaggaggtgacaggcgcagtggca
gtggaggtacctggaagaggacacggtgtctcagagttcagctttgcctatcaggaccca
aaagtactttccatcttcccagtccatggccctagagcaggaggtacccacctcaccctg
catggttctaagctcctgactggacggctagaggacatccgtgtcgtggttggagaccag
ccttgccacttgctcctggagcagcagtctgagcagctacactgtgagaccagcccaaac
cctgtgcctgccgaactcccagtgatggtctggttcggagccactgaacggaggcttcag
cacagccaattcaagtacacagcagaccccaacatcacctctgtgggccccgccaagagc
ttcttcagtggaggacgagagatatgggtccgaggccagaatctggatgtagtacagatg
ccaagaatccgagtgactgtgatcccaagagtaccacagcatggccaggggcttgggcag
aagcaccacgtggtccctgagaaaatcgaagagccatgtctcgtgaactcctcccacctc
atcatgtgccgctcgcctgccctccctggcccgccccaggacccttgggtccaggtggag
tttatccttgacaacatggtctttgactttgctacactgagccccacacccttctcctat
gaggctgatcccaccctgcgttccctcaaccccgaggatcccaccacgccattccggcac
aagccagggagtgtgttctctgtggagggggagaatctggaccttgccatgtctaaggaa
gaggtggtggccatgatcggagatggcccctgcgtggtgaagacactgacccggcaccac
ctgtactgcgagccccctgtggagcagcccctgccacatcaccatgccctccgtgaggcc
cccgacgctctgccggagttcacggtacagatggggaacctgcgcttctccctgggtcat
gtgcagtacgatggcgagagccctgtggcttttcctgtggcagcccaagtgggcttggga
gtgggcgtgtctctcctggctctgggggtcatcgtcattgtcctcatctacaggaggaag
agcaagcaggccctgagggactataaaaaggtgcagatccagctggagaatctggagagc
agtgtgcgggaccgctgtaagaaggagtttacagacctcatgacggagatgactgatctc
accagtgacctccttggcagcggcatccccttccttgactacaaagtgtatgctgagagg
gtcttcttccctgggcaccaggagtcacccttgcacagggacctcggtgtgcctgacagc
aggcgacccactgtggaacaggggctggggcagctctccaacctgctaaacagcaagctc
ttccttaccaagttcatccacacactggagagtcagcgtaccttctctgctcgagaccgt
gcctacgtggcatctctgctcactgttgcccttcacgggaagcttgagtacttcacggac
atcctccgtactctgctcagtgacctggtagcccagtgtgtagccaagaaccccaagctg
atgctgcgcaggacagagactgtggtggaaaagctgctcaccaactggatgtccatctgc
ctctacaccttcgtgagggactctgtaggagagcccctgtacatgctcttcagagggatt
aaacatcaagtggacaagggtcctgtggacagtgtgactggcaaagccaaatacactctg
aatgacaaccgcctgctcagagaggacgtggagtaccgtcccctgaccttgaatgctctc
ctggctgtggggcccggagcaggagaagcccagagtgtgccagtgaaagtcctggactgc
gacaccatctcccaggccaaggagaagatgctagaccagctttataagggggtgcctctc
gcccagcgccccgactctcgcaccttggatgttgaatggcggtctggagtggctgggcac
cttatcctttctgacgaggatgtcacttctgaacttgagggtctgtggaggcgtctgaac
acactgcagcattacaaggtcccagatggagcaacggtggcccttgtcccctgcctcacc
aagcatattcttagggaaaaccaggattatgtccctggagaacggactccgatgctggag
gatgtagatgaagggggcatccggccctggcacctggtaaagccgagtgatgaaccagag
cctcccaggccgaggaggggcagccttcggggtggggagcgagagcgagccaaggctatc
cctgagatctacctgacacgcctgctatccatgaagggcacactgcagaagtttgtggat
gacctgttccaggtgatcctcagcacaagccgccccgtgcctctggctgtgaagtacttc
tttgacctgctggatgaacaagcccagcagcatggcatctctgatcaggacaccatccac
atctggaagaccaacagcctgcctctgaggttctggatcaacatcatcaagaacccacag
tttgtgttcgatgtgcagacttcggataacatggacgcggtgctgctggtcatcgcacag
accttcatggatgcctgcaccctggccgaccacaagctgggccgggattctcccatcaac
aagcttctgtatgctcgagatattccccgttacaaacagatggtggaaaggtactatgca
gacatccgacagactgtcccagccagtgaccaagagatgaactcagtcttggcagagctg
tcccggaactgctctgccgaccttggtgctcgagtagctctgcatgaactctacaagtat
atcaacaagtactatgaccagatcatcactgccctggaggaggatggcactgcccagaag
atgcagctgggataccggctccagcagatcgcggctgctgtggaaaacaaggtcacggat
ctatag

DBGET integrated database retrieval system