KEGG   Rattus norvegicus (rat): 316033Help
Entry
316033            CDS       T01003                                 

Gene name
Glb1
Definition
(RefSeq) galactosidase, beta 1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00511  Other glycan degradation
rno00531  Glycosaminoglycan degradation
rno00600  Sphingolipid metabolism
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    316033 (Glb1)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    316033 (Glb1)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    316033 (Glb1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    316033 (Glb1)
   00511 Other glycan degradation
    316033 (Glb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    316033 (Glb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    316033 (Glb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     316033 (Glb1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   316033 (Glb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 316033
NCBI-ProteinID: NP_001101662
RGD: 1597145
Ensembl: ENSRNOG00000010196
UniProt: D3ZUM4
Position
8q32
AA seq 647 aa AA seqDB search
MFRVPLCMLLPLLALLQLLGAAHSFYNVSQRTFELDYKRDRFLKDGQPFRYISGSIHYFR
IPRFYWEDRLLKMKMAGLDAIQTYVPWNFHEPQPGQYDFSGDRDVEHFIQLAHQLGLLVI
LRPGPYICAEWDMGGLPAWLLEKESIVLRSSDPDYLAAVDKWLAVLLPKMKRLLYQNGGP
IITVQVENEYGSYFACDYNYLRFLEHRFRYHLGNDIILFTTDGAAEKLLKCGTLQDLYAT
VDFGTTGNITRAFLIQRNFEPKGPLINSEFYTGWLDHWGQPHSKVNTKKLVASLYNLLAY
GASVNLYMFIGGTNFAYWNGANMPYAPQPTSYDYDAPLSEAGDLTEKYFAVRDVIRKFKE
VPEGPIPPSTPKFAYGKVALRKFKTVTEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYR
TTLPQDCSNPKPIFSSPINGVRDRAYVSVDGVPQGILDRNRMNVLNIRGKAGATLDILVE
NMGRVNYGNSIKDFKGLISNMTLNFTVLTNWTMFPLDTEALARSHLGNWEAADEGHLDGH
STLRSSNFTLPTFYVGNFSIPSGIPDLPQDTFIQFPGWAKGQVWINGFNLGRYWPTKGPQ
MTLFVPRNILTTSAPNNITVLELESSPCSNGTLELCTVEFVDTPVIG
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgttccgggtccccctgtgtatgctgctcccgctcctggcgctcctgcagttgctgggc
gctgcgcacagtttctataatgtctcccagaggacatttgagctggactacaaacgggac
cgcttcctcaaggatgggcagccattccgctacatctcgggaagcattcactacttccgg
ataccccgattctactgggaggaccggctgctaaagatgaagatggctgggctggatgca
atccagacgtacgtgccctggaacttccatgaaccccagccaggacaatatgacttttct
ggggaccgtgatgtggaacatttcattcagctggctcaccagctgggactcctggtgatc
ctgaggcctgggccctacatctgtgcagagtgggacatggggggcttacccgcttggtta
ctagagaaagaatcgatcgttctccggtcttccgacccagattaccttgcagctgtggat
aaatggctggcagtccttctgcccaagatgaagcgtctgctctaccagaacggagggccc
atcataaccgtgcaggttgagaatgagtacgggtcctacttcgcctgcgattataactac
ctgcgtttcctggagcaccgcttccgctaccatttgggtaacgacatcattctcttcacc
actgacggagcagctgaaaaattactcaagtgtgggaccctgcaggacctctacgccaca
gtggattttggaacaaccggcaatatcacacgagctttcctgatccagaggaattttgaa
cccaaaggacctttgatcaattctgagttctatactggctggttagaccactggggtcaa
ccccattccaaagtgaatactaagaagttggtggcctccctctataacctgcttgcctac
ggggccagcgtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggt
gccaacatgccctatgccccacagccaaccagctatgactatgacgccccactgagcgag
gcaggagacctcactgagaagtacttcgcagtacgagatgtcattcggaagtttaaagaa
gtcccagaaggccctatccctccatctacacccaagttcgcatatggaaaagttgctctg
agaaagttcaagacggtgacggaagctctgggtatactgtgtcccaacgggcccgtgaaa
agcctctaccccttgacgttcactcaggtaaaacagtattttgggtatgtgctataccga
acgacacttcctcaagattgcagtaacccgaaacccattttctcttcacccataaatggt
gtccgtgatcgggcctacgtctctgtggacggggtcccccaaggaatccttgatcgaaac
cgtatgaacgttctgaacattcgggggaaggccggagccacgctagacattctggtggag
aacatggggcgtgtgaactatggcaactccatcaaagactttaagggtttgatttccaac
atgaccctcaacttcactgtcctcaccaactggacaatgttcccactggacactgaggcc
ctggcacgcagccatcttgggaactgggaggccgctgatgagggtcacctcgatggacac
tcgaccttacgttcttcaaatttcacactccccaccttttacgtgggcaacttctccatc
ccctcgggcatcccagacctgccgcaggacaccttcatccagtttcccggatgggccaag
ggccaagtatggatcaatggctttaacctcgggcgatactggcccacaaagggcccacaa
atgaccttgtttgtgccaaggaacatcctgaccacttcagccccaaacaacatcacagtg
ctagaactggagtcgtcaccctgcagtaatgggaccctagagctatgtacagtagagttt
gttgacactccggttattggctga

DBGET integrated database retrieval system