KEGG   Rattus norvegicus (rat): 316067
Entry
316067            CDS       T01003                                 

Gene name
Xylb
Definition
(RefSeq) xylulokinase
  KO
K00854  xylulokinase [EC:2.7.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno01100  Metabolic pathways
Module
rno_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    316067 (Xylb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     316067 (Xylb)
SSDB
Motif
Pfam: FGGY_C FGGY_N LSDAT_euk
Other DBs
NCBI-GeneID: 316067
NCBI-ProteinID: NP_001028876
RGD: 1307372
Ensembl: ENSRNOG00000014168
UniProt: Q3MIF4
Position
8q32
AA seq 536 aa
MAERAGRRCCLGWDFSTQQVKVVAVDAELNVFYEDSVHFDRDLPEFGTQGGVHVHKDRLT
VTSPVLMWVQALDLILEKMKASGFDFSQVLALSGAGQQHGSVYWKTGASLALSSLSPALL
LHQQLQACFSVSDCPIWMDSSTTAQCHQLEAAVGGAQALSCLTGSRAYERFTGNQISKIF
QKNPEAYSNSERISLVSSFAASLFLGRYSPIDYSDGSGMNLLQIQEKVWSQACLDACAPH
LKEKLGSPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDVAVSLG
TSDTLFLWLQKPMPALEGHIFCNPVDARQYMALLCFKNGSLMREKIRDESASCSWNKFSK
ALQSTEMGNNGNLGFYFDVMEITPEIIGCHRFNADNMEVSAFPGDVEIRALVEGQFMAKR
IHAEGLGYRIMPKTKILATGGASHNKDILQVLADVFGAPVYVIDTTSSACVGSAYRAFHG
LAGGTGVAFSEVVKSAPQPSLAATPNPGASQVYAALLPRYAELEQRILSKARGPLE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcggagcgggcgggccgccgctgttgcctgggctgggacttcagcacgcagcaggtc
aaagtcgttgctgttgatgcagagctgaacgtcttctatgaggacagtgtgcattttgac
agagaccttccggaatttggaactcagggcggtgtccatgtacacaaggacaggctgacg
gtcacctctccggtcctgatgtgggtccaggctctggacctgatcctggagaagatgaag
gcttccggctttgacttctctcaagttctagccttatctggggcaggccagcaacacgga
agcgtttactggaagactggagccagcctggcgttgtcaagcctgtcaccggctctcctg
ttgcatcagcagctacaggcctgcttctccgtcagtgactgcccgatatggatggactcc
agtaccacagcccagtgtcaccagctggaggctgcggtgggtggggcccaggctctcagc
tgcctcacagggtcccgggcctatgagcgatttacggggaaccagatctcaaagattttc
cagaagaaccctgaggcctactcgaactctgagagaatttccttggtcagtagttttgct
gcttcgctgttcctgggtaggtactcgcccatcgactacagtgatgggtctggaatgaat
ttgttgcagatccaggaaaaagtctggtcccaggcttgcctggatgcctgtgccccccat
ttgaaggagaagctgggttcaccggtcccttcctgctctgttgtgggagccatttcttcc
tactacgttcagcgctatggattccctccaggatgcaaagtggtggccttcactggggac
aacccggcatcactggccggcatgaggctggaggaaggagatgttgcggtcagcctgggc
accagtgacaccctatttctctggctccaaaagcccatgcctgccttggaagggcacatc
ttctgcaacccagtggatgcacggcaatatatggcgcttctgtgctttaaaaatggctcc
ctcatgagagagaagattcgagacgagtctgcttcctgttcctggaacaagttctctaag
gccctgcagtccactgagatggggaacaacggaaacttgggtttttatttcgatgtcatg
gagatcacccctgagattatcgggtgccataggtttaatgcagataacatggaggtctcg
gcattccctggagatgtggagatccgagcgctggttgaaggccagttcatggccaagagg
attcatgcagaaggcctaggctaccgaatcatgcctaagacaaagattctggccacggga
ggagcctctcacaataaagacatcttgcaggtgcttgcagatgtttttggggcccctgtg
tatgtcatagacaccaccagttcagcctgtgttggctccgcataccgagcctttcacggc
cttgcaggagggacaggtgtagccttttcagaggtggtaaaatcagcaccacagcccagc
ctggctgccacccccaacccaggagcttcccaggtttatgcagcccttctccctcgatat
gctgaactggaacagagaatcttgtccaaagctcgggggcctctggaatga

DBGET integrated database retrieval system