KEGG   Rattus norvegicus (rat): 316129Help
Entry
316129            CDS       T01003                                 

Gene name
Uhrf1, Ac2-121, Np95
Definition
(RefSeq) ubiquitin-like with PHD and ring finger domains 1
  KO
K10638  E3 ubiquitin-protein ligase UHRF1 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    316129 (Uhrf1)
   03036 Chromosome and associated proteins [BR:rno03036]
    316129 (Uhrf1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     316129 (Uhrf1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    316129 (Uhrf1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   Other histone modification proteins
    316129 (Uhrf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TTD SAD_SRA ubiquitin PHD Rad60-SLD zf-C3HC4_2 zf-C3HC4 zf-RING_10 zf-RING_UBOX Prok-RING_4 zf-RING_2 zf-RING_5 Agenet
Motif
Other DBs
NCBI-GeneID: 316129
NCBI-ProteinID: NP_001008882
RGD: 1595855
Ensembl: ENSRNOG00000048411
UniProt: Q7TPK1 A0A0G2JT07
Position
9q12
AA seq 829 aa AA seqDB search
MESGIFGEGGSLPPLPVLLRGLQDLGLLGKLDIARRATLTGISLCFSVFLQHIGIMWIQV
RTMDGKETHTVNSLSRLTKVQELRKKIEELFHVEPQLQRLFYRGKQMEDGHTLFDYDVRL
NDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGTADGDDKTVWED
TDLGLYKVNEYVDVRDNIFGAWFEAQVVQVQKKALSEEEPCSSSAIMAPEDDIMYHIKYD
DYPEHGVDIVKAKNVRARARTVIPWEDLEVGQVVMANYNVDYPRKRGFWYDVEICRKRQT
RTARELYGNVMLLNDSQLNNCRIIFVDEVLKIELPNERSPLIGSPSRRKSGPSCQYCKDD
ENKPCRKCACHICGGREAPEKQVLCDECDMAFHLYCLQPPLTCVPPEPEWYCPSCRTDSS
EVVQAGEKLKKSKKKAKMASATSSSRRDWGKGMACVGRTTECTIVPANHFGPIPGVPVGT
MWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNFFTYTGSGGRDLSG
NKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAP
AEGNRYDGIYKVVKYWPEKGKSGFIVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPE
GYLEALANKEKNRKRPAKALEQGPSSSKIGKSKRKSTGPATTSPRVSKKSKLEPYTLPLQ
QANLIKEDKGNAKLWDDVLSSLQDGPYQIFLSKVKEAFQCICCQELVFRPVTTVCQHNVC
KDCLDRSFRAQVFSCPACRYDLDHSSPTRVNQPLQTILNQLFPGYGSGR
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggagtcaggaatctttggcgagggaggatcccttcctcctctcccggtattgctacgg
ggtttacaagacctgggccttcttggtaaactagatatagcccgcagggccacactgact
gggatctccctctgtttttcagtattccttcagcacatcggcatcatgtggatccaggtt
cgaactatggatgggaaggagacccacaccgtgaactctctatcccggttgaccaaggtg
caggagctgaggaaaaagattgaggagctgtttcacgtggaaccccaattgcagagactc
ttttacaggggcaaacagatggaggatggtcacacactcttcgattatgacgtgcgcctc
aatgacacaatccagctgctggtgcgccagagtctggccctacctctcagtacgaaagaa
cgggactcggagctctcagactctgactctggctatggtgtgggtcacagtgaatcagac
aagtcgtccacgcatggtgaagggacagctgatggggatgacaagactgtgtgggaggac
actgacctaggactgtacaaggttaatgagtacgtggacgtgcgtgacaatatctttggt
gcatggtttgaggcccaggtggtccaggtacagaagaaagccctatctgaggaagagccc
tgtagctccagtgccattatggccccagaggatgacatcatgtaccacatcaagtatgat
gactatccagagcatggagtggacattgtcaaagccaagaatgtccgtgctcgcgctcgc
actgtgatcccctgggaggacctggaggtgggtcaggtggtcatggccaactacaacgtg
gactatcccagaaaacgtggcttctggtatgatgttgagatttgtaggaagcgccaaacc
aggacggcacgtgaactgtatggcaacgtcatgcttttgaatgattctcagctcaacaac
tgtcggatcatatttgtggatgaagtcttgaagattgagctccctaatgagaggagcccc
ttgattggtagcccctcgagacggaagagcggcccatcctgccagtactgcaaggatgac
gagaacaaaccgtgtcgcaagtgtgcctgccatatttgtggtgggcgtgaggctcccgag
aaacaagtgttgtgtgatgagtgtgacatggccttccacctgtactgcctgcagccaccg
ctcacctgtgtcccccctgagccagagtggtactgccccagctgccgaactgactccagt
gaggtggtacaagcaggggagaaactgaagaaaagcaagaagaaggcaaagatggcgtca
gccacttcctcctcccgacgggactggggcaagggcatggcatgtgtgggccgcaccaca
gagtgtactattgtaccggccaaccacttcgggcccatccctggtgtccccgtgggcacc
atgtggcgcttcagagtccaggtcagtgagtccggtgtgcatcggccacatgtggcgggt
attcatggtcggagcaacgacggtgcctactcactggtgctggctggtggctatgaggat
gatgtggataatggcaatttcttcacctacacgggcagtggtggccgagacctctctggc
aacaagcgtacagcgggacagtcctctgaccagaaactcactaataacaacagggctctg
gcgctcaattgccactccccaatcaatgagaaaggtgcggaggctgaagactggcgccag
ggtaagccggtgcgtgtggtccggaacatgaagggaggcaaacatagcaagtacgcacct
gcagaggggaaccgctatgatggcatctacaaggtggtcaagtactggccggagaagggg
aaatctggcttcattgtgtggcgctatctccttcgacgggatgacactgaacctgagccg
tggactcgggagggcaaggaccgcactcggcagctgggcctcactatgcagtatcctgaa
ggctacttggaggccttggctaacaaggagaagaacaggaagcgcccggccaaggccttg
gagcagggaccatcatcttccaagataggcaaaagcaagcggaagtccacaggcccggcc
accacaagcccccgtgtctccaagaagagcaagctggagccctacacacttccattgcag
caggccaacctcatcaaggaggacaagggcaacgccaagctgtgggatgacgtgctgagc
tcccttcaggatgggccgtaccagatcttcctgagcaaggtgaaggaggctttccagtgc
atctgttgccaggagttggtgttccggccagtcaccaccgtgtgtcagcacaacgtttgt
aaggactgcctggacaggtccttccgtgcccaggtgttcagctgcccagcatgtcgctat
gacctggaccacagctccccaacccgagtgaatcagcccttgcagaccattctcaaccag
ctcttccctggctatggcagcggccggtga

DBGET integrated database retrieval system