KEGG   Rattus norvegicus (rat): 316137Help
Entry
316137            CDS       T01003                                 

Gene name
Adgre1, Emr1
Definition
(RefSeq) adhesion G protein-coupled receptor E1
  KO
K04591  adhesion G protein-coupled receptor E1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    316137 (Adgre1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    316137 (Adgre1)
Peptidases [BR:rno01002]
 Mixed Peptidases
  Family P2
   316137 (Adgre1)
G protein-coupled receptors [BR:rno04030]
 Adhesion receptor family
  EGF-like module-containing mucin-like hormone receptor-like (EMR)
   316137 (Adgre1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 EGF_CA cEGF EGF_3 EGF_MSP1_1 GPS hEGF FXa_inhibition EGF GAIN EB
Motif
Other DBs
NCBI-GeneID: 316137
NCBI-ProteinID: NP_001007558
RGD: 1359214
Ensembl: ENSRNOG00000046254
UniProt: Q5Y4N8
Position
9q12
AA seq 932 aa AA seqDB search
MWGFWLLLFWGFSGTHRWGMTTLAILGQRLNGVNECQDTTTCPAYATCTDTTESYYCTCK
QGFLPSNGQTNFQGPGVECQDVNECLRSDSPCGSNSVCTNIPGRARCSCLSGFSSSAGGS
WILGSPGHFLCTDVDECLTIGICPKNSNCSNSVGSYSCTCQSGFVSNGSTCEDEDECVTR
NACPEHATCHNTLGSYYCTCNEGLEFSGGGPMFQGLEESCEDVDECSRNSTLCGPSFICI
NTLGSYSCSCPAGFSLSTFQIPGHPADGNCTDIDECDDICPSNSSCTNTLGSYFCTCHPG
FASSNGQLNFTDQEVTCEDIDECTQDPFRCGRNSSCTNVPGSYNCSCLPDFRMDPGGSQA
HGNFTCKRIPFKCKEDLIPKSEQIEQCQAGQGRNLDYTSFCTFVNATFTILDNTCENKSA
PVSLQSAATSVSLMLEQASTWFEFSREETSTLGTILLETVESTMLAALLTPSGNASQTIR
TEYLEIESKVINEECNEENVSINLKARGDKMDVGCFIIKESESTGTPGVAFVSFAHMDSV
LDERFFEDGQASWKLRMNSHVVGGTVTGERKEDFSKPIVYTLQHIQPKQKSERSICVSWN
TDVEDGRWTPSGCETVEASETHTVCSCNRMTNLAIIMASGELTMEFSLYIISYVGTVISL
VCLALAIATFLLFRAVQNHNTYLHLHLCVCLFLAKILFLTGIDKTDNQTACAIIAGFLHY
LFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHLCAFGYGLPVVVVIISATVHPW
GYGMHNRCWLNTETGFIWSFLGPVCMIITINSALLAWTLWVLRQKLCSVNSEVSKLKDTR
LLTFKAIAQIFILGCSWVLGIFQIGPLASIMAYLFTTINSLQGAFIFLIHCLLNRQVRDE
YRKLLTRKTDLSSHSQTSGILLSSMPSTSKTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcttttggctgctcctcttctggggcttcagtggaacgcacagatgggggatg
accacacttgccatcctgggacaaagacttaacggtgtgaatgaatgtcaagacactacc
acttgtccagcttatgccacctgcactgacaccacggagagttattactgtacctgtaaa
caaggttttctgcccagcaatggacaaaccaactttcagggcccaggagtggaatgtcaa
gatgttaatgaatgtcttagaagcgactcgccttgtggttctaactcagtctgcaccaat
atcccaggacgagccaggtgcagttgtcttagtggcttctcttcttccgctggtggaagt
tggatcctgggaagtccgggtcattttctctgcacagatgttgacgagtgtctgacaatt
gggatctgccctaagaattctaactgctctaactctgtggggagctacagctgcacctgc
caatcaggctttgtctcgaatggctccacttgtgaagatgaagatgaatgtgtgactcgt
aatgcttgcccagagcatgcaacctgccacaacactcttggaagctattattgtacatgc
aacgaaggacttgaatttagtggaggaggaccaatgttccagggcctggaagaatcttgt
gaagatgtggatgagtgctccaggaattcaacgctttgtggtccctccttcatttgcatc
aacacgctgggatcctacagctgttcttgcccagctggattctctttgtcaacttttcag
atccctggtcatccagcagatgggaattgtacagatatagatgagtgtgatgacatatgc
ccttccaactcatcatgtaccaacacccttgggagctacttctgcacttgccaccctggc
tttgcctcaagcaatggacagctgaatttcacagaccaagaagtgacatgtgaagatatt
gatgagtgcactcaagatccatttcgatgtggacgaaattcttcctgcaccaatgtacca
ggttcctacaactgcagctgtcttcccgactttcgaatggatccaggaggctcccaagca
catggaaacttcacatgcaaaaggattcccttcaagtgtaaggaagacttgatacccaaa
agtgagcagatagagcagtgccaagcagggcaaggccggaatcttgattatacttccttc
tgcacatttgtgaatgccacctttaccatcctggataacacctgtgaaaacaaaagtgct
ccagtgtccttacagagtgcagctacaagtgtctccctcatgctggagcaagcatcgacc
tggtttgagttcagcagggaagagacatctactctgggcactatcttgctggagactgtg
gaaagcaccatgttggctgctcttctgacaccctctgggaatgccagtcagaccattcgg
acggagtacttggaaattgaaagcaaagtcatcaatgaagaatgcaatgaggagaatgtg
tccattaacttgaaagccagaggggacaagatggatgttggctgtttcataatcaaagaa
tcagaatctacagggaccccaggagtggcttttgtctcctttgcacacatggactcagtt
ttagatgagcgcttctttgaagatggtcaggcctcctggaaactgaggatgaattcccat
gttgttggtggcactgtaaccggggagaggaaggaggacttctccaagcctatcgtctat
accctccagcacatccagccaaagcagaagtctgagaggtctatatgtgtctcctggaac
accgatgtggaggatgggagatggacaccctcgggctgtgagactgtagaagcatctgag
acacacacagtctgcagctgtaaccggatgacaaatttggccatcatcatggcttctggg
gagcttacaatggaattttccttgtatatcatcagctatgtgggtacagtcatctctctg
gtatgtctcgccttggccatagccaccttcctgttgtttcgtgcagttcagaaccacaac
acctacctgcacctgcacctttgtgtgtgtctcttcttggccaagattctcttcctcacc
ggtatagacaagactgacaaccagacagcttgcgctatcattgcgggatttctacactat
cttttccttgcctgcttcttctggatgctggtggaggcagtgatgctcttcctgatggtg
agaaacctgaaggtggtgaattatttcagctctcgcaacatcaagatgctgcacctctgt
gcctttggctatgggctcccagtcgtggtggtcattatctctgctactgtacatccatgg
ggctatggaatgcataatcgctgctggctgaatacggagacaggattcatttggagtttc
ttggggccagtctgcatgatcatcacgatcaactctgccctccttgcctggacactgtgg
gtgctgaggcagaagctctgcagtgtcaactcagaagtctctaagctcaaggatacgagg
ttgctgaccttcaaggccattgcccagattttcatcttgggttgctcctgggtgctgggc
attttccagattggtcccttggcaagcataatggcatacctgttcaccactatcaacagc
cttcagggggccttcatcttcctcattcactgtctgctcaaccgccaggtacgagatgaa
tataggaaactcctcaccaggaagactgatcttagctcccattcccagacttctgggatt
ttactgtcatctatgccttccacttctaagacgggttaa

DBGET integrated database retrieval system