KEGG   Rattus norvegicus (rat): 316164Help
Entry
316164            CDS       T01003                                 

Gene name
Satb1
Definition
(RefSeq) SATB homeobox 1
  KO
K23225  DNA-binding protein SATB1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    316164 (Satb1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    316164 (Satb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUT CUTL ULD Homeodomain SUIM_assoc HTH_3 RuvA_C
Motif
Other DBs
NCBI-GeneID: 316164
NCBI-ProteinID: NP_001012129
RGD: 1305561
Ensembl: ENSRNOG00000012942
UniProt: Q5U2Y2
Position
9q11
AA seq 764 aa AA seqDB search
MDHLNETTQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGGKMQGVPLKHS
GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP
PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLLSTPPSRPPQVKTATLA
TERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP
ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQLQQQQQQQQ
QQQQQQQPPPPPPQPQPQPQAGPRLPPRQPTVASSAESDEENRQKTRPRTKISVEALGIL
QSFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEY
KDEELLKDLEESVQDKNANTLFSVKLEEELSVEGSTDINADLKD
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggatcatttgaacgagacaactcaggggaaagagcattccgaaatgtctaacaatgtg
agtgatccgaagggtccgccggccaagattgcccgcctggagcagaacgggagcccacta
ggaagaggaaggcttgggagcacaggtggaaagatgcagggagtgcctttaaaacactcg
ggccacctcatgaaaaccaaccttaggaaaggaaccatgttacccgttttctgtgtggtg
gaacattatgaaaacgccatcgagtatgattgcaaggaggagcatgcggaatttgtgttg
gtgaggaaggatatgcttttcaaccagctcatagagatggcgttgctgtctctgggctat
tcacacagctctgctgcccaagccaaagggctcatccaggttgggaagtggaatccagtt
ccactgtcgtatgtgacagatgcccctgatgccacagtggcagacatgcttcaggatgtg
taccatgtggtcactctgaaaatccagctgcacagttgccccaaactagaagacttgcct
cctgaacaatggtcccacaccacagtaaggaatgctctgaaggacttactgaaagacatg
aaccagagttcgttggccaaggagtgccccctctcacagagcatgatctcctccatcgtg
aacagcacgtactatgcaaatgtctcagcagcaaaatgtcaagagtttggaaggtggtac
aaacatttcaagaagacaaaggatatgatggttgagatggatagtctgtctgagctatcc
cagcaaggcgccaaccatgtcaattttggccagcagcctgtcccaggaaacacagctgag
cagcctccgtcccctgcacagctctcccacggcagccagccctctgtccggacccctctt
ccgaacctgcaccctgggcttgtgtcaacacctatcagtcctcagctggtcaaccagcag
ctggtgatggcccagttgctgaaccagcagtatgcagtgaacagactcttggcccagcag
tccttaaaccaacagtacttgaaccaccctccccctgtcagtaggtctatgaacaagcct
ttggagcagcaagtttccaccaacaccgaggtctcttccgaaatctaccagtgggtgcgg
gatgaactgaaacgagccggaatctcacaggcagtgtttgcacgagtggcttttaacaga
actcagggattgctttctgaaatcctccgcaaggaagaggaccccaagactgcatcccag
tctctgctggtaaaccttcgggctatgcagaatttcttacagttgccagaagctgaaaga
gaccggatataccaggatgagagggaaaggagcttgaacgcagcctccgccatggggcct
gccccgctgctgagcacgccacccagccgccctcctcaggtgaaaacagctaccctcgcc
actgagaggaatgggaagccagagaacaatactatgaacattaacgcctccatttatgac
gagattcagcaggaaatgaagcgtgctaaagtgtcccaagcactgtttgcaaaggttgct
gccacaaaaagccagggatggctgtgcgagctgctgcgctggaaagaagacccttctcca
gaaaacagaaccctgtgggagaacctgtcaatgatccgaagattcctcagtctgcctcag
cctgagcgcgatgccatctatgagcaggagagcaatgccgtgcatcaccatggcgacagg
cctccccacatcatccatgttccagcggaacagcttcagcagcagcagcagcagcagcag
caacagcagcagcaacagcagccaccgccaccacctccacagccacagccacagccccag
gcaggccccaggctcccaccccggcagcccaccgtggcctcctctgcagagtccgatgag
gaaaaccggcagaagaccaggccacgaaccaaaatttccgtggaagccctgggcatcctt
cagagtttcatccaagatgtcggcctgtacccggatgaagaggccatccagaccctgtcg
gcgcagctggacctcccgaagtacaccatcatcaagttctttcagaaccagcggtactac
cttaagcaccacggcaagctgaaggacaactccggcttggaggtggatgtggctgagtac
aaagatgaggagttgcttaaggatttggaggagagcgtccaggataaaaacgccaacacc
cttttttcggtgaaactagaggaagagctatccgtggaagggagcacagacattaatgcc
gacctgaaagactga

DBGET integrated database retrieval system