KEGG   Rattus norvegicus (rat): 316209
Entry
316209            CDS       T01003                                 

Gene name
Med20, Trfp, Usp49
Definition
(RefSeq) mediator complex subunit 20
  KO
K13528  mediator of RNA polymerase II transcription subunit 20
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    316209 (Med20)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Head
     316209 (Med20)
SSDB
Motif
Pfam: Med20
Other DBs
NCBI-GeneID: 316209
NCBI-ProteinID: NP_001013196
RGD: 1306415
Ensembl: ENSRNOG00000013852
UniProt: Q5XIE9
Position
9q12
AA seq 212 aa
MGVTCVSQMPVAEGKSVQQTVELLTKKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQAG
KLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYC
DFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPTVFGNRH
DAVYGPADTMVQYMELFNKVRKQQQVPVAGIR
NT seq 639 nt   +upstreamnt  +downstreamnt
atgggagtgacgtgtgtgtcccagatgcctgtggctgagggcaagagtgtccagcagaca
gtggagctcctcaccaagaaattggagatgcttggagcagagaaacaaggaacattttgt
gtggactgtgaaacttaccacacagctgcctccaccctgggcagccaaggccaggctggg
aagctgatgtacgtgatgcataactctgagtacccactgagctgctttgccctctttgag
aatggcccttgccttattgctgacaccaacttcgatgtgctcatggtgaagctcaagggc
tttttccagagtgccaaggccagcaagattgagacccggggtactcgctaccagtattgt
gacttcctggtgaaggtgggcacggtcacaatggggcccagtgcccgtggcatctctgtg
gaggtggagtatggcccttgtgtggtagctagtgactgctggagcctcctgcttgaattc
ctacagagttttctaggtagccacacaccaggggcgcccacagtgtttgggaacagacat
gatgcggtctacgggccagcagataccatggtacagtacatggagctcttcaacaaggtc
cggaaacagcagcaagtgcctgtggctgggatccgctag

DBGET integrated database retrieval system