KEGG   Rattus norvegicus (rat): 316228
Entry
316228            CDS       T01003                                 

Gene name
Cul9
Definition
(RefSeq) cullin-9
  KO
K11970  cullin 9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    316228 (Cul9)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul9 complex
    Cullin
     316228 (Cul9)
SSDB
Motif
Pfam: Cul7 Cullin IBR Cullin_Nedd8 ANAPC10 HEAT TFCD_C
Other DBs
NCBI-GeneID: 316228
NCBI-ProteinID: NP_001178511
RGD: 1562008
Ensembl: ENSRNOG00000018372
UniProt: D3ZZP8
Position
9
AA seq 2514 aa
MVGEQRAGDLMVPLGPRLQAYPEELIRQRPGHDGHPEYLIRWRVLKCSEEGKVSLEEEKT
EYLLMWLSAPEVYANCPMLLRERSVSKGPQYEPTGEVGSFPRDPGGLDELAMAEMEDDVR
ALVRRAARQLAEGGASNLTVAVLHTIHVLSAYASIGPLTGVFRETGALDLLMHMLCSPEP
QIRRSAGKMLQALAAHDAGSRAHVLLSLSQHEGIEQHMDFDSRYTLLELFAETTSTEEHC
MALEGIHLPQLPGKLLFSLVKRYLCVTSLLDQLNNSPESGAGDQSSPCLPKEKSRGQREL
EFSMAVGNLISELVRSMGWARNLSEQGALPPRPSRSIFQPCLSGPPLLLPTIVTTPRKPG
RAFRGRSEFSSRSGYGEYVQQTVQPGMRVRILDDYEEISAGDEGEFQQSNNGVPPVQVFW
QSTGRTYWVHWHMLEILGPEEATREPASAAVEKGAGATALGTACPSWDRKPAHGLYSLPY
LQPESQKSEEPGYLTQGEWWELLFFIKKLDLCEQQPIFQNLHEKLDKEAVGEKTLGEISV
PIEMAEGVLQVLSNRFEGSNLCDLLNSHIYTKYGRLPKEPGRLPPSRGHSCTSEPEEGSE
SAASFSEKEESPKAEAEPAGAKPESPKAQSDSQLFNQLLVTEGMALAPETQAAATEMART
LRGPGPRSSLDQHVAAVLATVQISSLDTNLQLSGLGALSQAVEEVTERDHPLVRPDRSLR
EKLVKTLVDLLTNQVGEKMVVVLALRLLYLLMTKHEWRPLFAREGGIYAVLICMQEYKTS
VLVQQAGLAALKMLAIANSSEVPTFVTGRDSIQPLFDTQMTREIFASIDSATRPGSESLL
LSVPAAVVLMLNTEGCSSAVRNGLLLLNLLLCNHHTLGDQIITQELRDTLFRHSGIAPGT
EPMPTTRTILMMLLSRYSEPWGSPERAALETPSTQGQDGSPESLIRSLVGDLSAELFLDL
ERVLCHEGSPQGAMTPLLKRLQQETQPFLLLLRTLDAPGPNRALLLTVLRVMTRLLDYPE
TMVLPWHEVLEPCLNCLNGPSSDSEVVQELTCFLHRLALMHKDYAVVLCCLGAKEALSKV
LDKHSTQLLLASELRHLVTECEKYAQLYTNLTSSLLAACIQMVLGQIEDHRRTYKPINIP
FFDVFLRHLCQGSSVEVKEDRCWEKVEVSSNPHRASKLTDRNPKTYWESNGSTGSHSITL
HMHRGVLIRQLTLLVASEDSSYMPARVVVFGGDSVGCISTELNTVNVVPSASRVTLLENL
SRFWPIIQIRIKRCQQGGIDTRVRGVEVLGPKPTFWPLFREQLCRRTCLFYTIRAQAWSR
DIAEDRQRLLQLYPRLNRVLRHEQNFADRFLPDDEAAQALGKTCWEALVSPLVQNITSPD
AGGVSSLGWLLDQYLEHREKARSRQGQAASFASQVRRLCHLLVHVEAPPGPSPEPSSQPL
SKSSKSQDGSPAPAPVRPSTTLRNITQCWLAVVQGQASRFLASAWRASDFVPRYCDLYER
LQRAGSELFGPRAAFTLALRSGFSGALLQQSFLTAAHISEQFARHIDQQIQGGLLGGAAG
VEMLGRLQRHLEPIMVLSGLELATTFEHFYQYYMADRLLSLGSSWLEGAVLEQIGLCFPN
RLPQLMLQSLRTSEELQRGFLLFQLQQLDRQLLEQGEQEEWKLERLEEEDRGQETGRELL
TEDPGPAISVLVLSPRCWPVSPLCYLHQPRKHLPTEFCDALDGFSSFYSHSQHYPVLDMG
PHRRLQWTWLGRAELQFGDQTLHVSTVQMWLLLNFNQTEEVSVEILLRNSGLSPELLHQA
LLPLTSDSGPLTLEEAQDFPQGGVLRLREPRSQTHEEVLWLIPPQTYLSVEKDEGRTLEQ
KRNLLSCLLVRILKAHGEKGLHIDQLVCLVLEAWQKGPNPPGRLGRSAAVGVACSSTDVL
SCILHLLGQGYVERRDDRPQVLMYATPEPMGHCRGQADVPFCGNQSTETSKPSPEAVVAL
ASLQLPAGRTMSPQEVEGLMEQTVRQVQETLNLEPDVAQHLLAYSHWGTEQLLQSYSEDP
EPLLLAAGLRVPQPQEVPARPDQCPVCISPLGPNDDSPSLCCLHCCCKSCWNEYLTTRIE
QNFVLNCTCPIADCPAQPTGAFIRNIVSSPEVISKYEKALLRGYVESCSNLTWCTNPQGC
DRILCRQGLGSGTTCSKCGWASCFNCSFPEAHYPASCGHMSQWVDDGGYYDGMSVEAQSK
HLAKLISKRCPSCQAPIEKNEGCLHMTCARCNHGFCWRCLRSWKPSHKDYYNCSAMVSKA
ARQEKRFQDYNERCTFHHQAREFAVNLRNQASAIHEVPPPKSFTFLQDACRALEQARKVL
AYACVYSFYSQGTEYMDVVEQQTENLELHTNALQILLEETLLRCQDLASSLRLLRADCLS
TGTELLRRIQERLLAILQHSTQDFRVGLQSPSVETREVKGSNVPSDQPQGSSGLEVEDEE
EEEEEEEEEDVPEWQHEFDEELDNDSFSYDEESENLDRETFFFGDEDDDDESYD
NT seq 7545 nt   +upstreamnt  +downstreamnt
atggtaggagaacagcgagcaggggaccttatggtacccttggggcctcggctgcaggca
taccctgaagaactcattcggcagagacctggacatgacggccatcctgaatacctgatc
cgttggcgtgtcctcaagtgtagcgaagagggcaaagtgagcttagaggaggagaagaca
gagtacctcctcatgtggctgtcagccccagaggtctatgccaactgccccatgctactt
cgggaacgatcagtgtctaaaggcccacagtacgaacccaccggagaggtggggagcttc
ccacgagacccaggaggcctggacgagttggcaatggcagagatggaggacgatgtgcgg
gcgctggtgcgcagggctgccaggcagctggcagaaggtggggcctccaacctgacggtt
gctgtgcttcataccatccacgtgctcagtgcctatgccagcattgggcctctcaccggg
gtcttcagggagacaggagccctggatctgctaatgcacatgctgtgcagtccggagcct
cagatccgtcggagtgcaggcaagatgctacaggctctggcagcccatgatgctgggagc
cgggctcacgtccttctgtcactgagccaacatgagggcatcgagcaacacatggatttt
gacagccgctacactttactggagctgttcgcagagaccacgtccacggaggagcactgc
atggccttggagggcatccaccttcctcagctccctgggaagctgctcttctccctggtg
aaacgctacctatgtgtcacgtccctgctggatcagctgaataacagcccagagtcagga
gctggagaccagagctctccgtgtctcccaaaggagaagagtcggggacagcgggagctg
gagttcagtatggcggtgggcaacctcatttcagagctggtgcggagcatgggctgggcg
cggaacctcagtgagcagggcgccttgccgccccggccttcccggtccatcttccagccg
tgcctctcaggccctccactgctgctgcccaccatcgtcactacgcccaggaagccagga
cgggccttccgcggccgttctgaattttccagccgcagtggttacggtgaatatgttcag
cagacggtgcagcccggcatgcgcgttcgcatcctggatgactacgaagagatcagtgct
ggggacgagggcgagttccagcagagcaacaatggcgtgcctcctgtgcaggtcttctgg
cagtcaaccggccgcacctactgggtccactggcacatgctagagatcctggggcctgag
gaagccactagggagccagcatcagcagctgtggagaagggagcaggggcaactgccctg
ggcacagcgtgtccctcctgggacaggaagccagcgcatggcctctactcactaccgtat
ctacagcccgagtcccagaagagcgaggagccagggtacctgacccagggagagtggtgg
gagctacttttcttcatcaagaagttggacttgtgtgagcagcagccaattttccagaat
ctgcatgagaaactggataaggaggccgtgggagaaaagactctgggagagatctctgtg
cccatagagatggctgagggtgtgctgcaggttctcagtaaccgctttgagggcagcaac
ctctgtgacctgctcaactcccacatctacaccaagtacggacggctgcccaaggaacca
gggcgcttaccgccttcacggggtcactcctgtacctccgagccagaggaggggtcggag
tcagccgccagcttctcagagaaggaagagtccccaaaggcagaggcggagcccgcaggc
gcaaagccggagtcccccaaagcacagagcgactcccagctgttcaatcagcttctggtg
actgaggggatggctctggcccctgaaacacaggcggcagctactgaaatggccagaacc
ttgcggggtcccggtccacgcagctccctggatcagcatgtggcagccgtcttagccact
gtgcagatctccagcctggatacaaacctgcagctttcagggctcggtgccctctcccag
gcggtggaggaggtcactgagcgggaccaccctctggtccgtcctgacagatccttgaga
gagaagctcgtgaagaccctggtggatttgctgaccaaccaggtgggagagaagatggtg
gtggtgctggccctgcgcctcctctacctgctcatgaccaagcatgaatggcgtccgctc
tttgccagggagggtggcatctacgctgtgctgatctgcatgcaagaatacaagacatct
gtcttggtgcagcaggcgggactggcagcgctaaagatgctagccattgctaattcctcc
gaggtgcccacttttgtcaccggccgagattccatccagcctctgtttgatacccagatg
accagagagatctttgccagcattgactctgccacacgtccaggctctgagagcttgctc
ctcagtgtacccgcagccgtggtcctgatgctgaataccgaggggtgctcctctgcagtg
agaaatggcctgctgctactcaacctgcttctgtgtaaccaccacactctgggagaccag
atcataacccaggagctgagagacaccttgttcaggcactcagggatagcgccggggaca
gaaccaatgcccaccacacgcaccatcctcatgatgcttctcagtcgctactcagagcct
tggggaagtcctgagcgagcagcactggagaccccaagcacccagggtcaggatgggtcc
cctgagtcactcatccgatctctggtgggggacctgtcagcagaactcttcctggacttg
gagcgtgttctgtgccacgaaggcagccctcaaggtgccatgacgcccctcctcaagcgc
ctccagcaggaaacacagcctttccttctgttgctgcggactctagatgcccctgggccc
aacagagctctgctgctcaccgtactcagggtcatgacacgactactggattatcctgag
acaatggttctcccctggcacgaggtcttggagccctgcctcaactgcctgaatgggcca
agcagtgactctgaggttgtccaggaactgacctgcttcctgcaccgcctggctctgatg
cacaaagactatgcggtagtgctttgctgcctgggagccaaagaagccctctccaaagtc
ctggacaagcactccactcagctcctgctggcctcggagctccgccacctggtgacggag
tgcgagaagtacgcccagctctacactaacctcacctcgagcctcctggctgcctgcatc
cagatggtgctgggccagattgaagaccacaggcgaacctacaagcccatcaacatcccc
ttctttgatgtgttcctcaggcatctctgccagggctccagtgtggaagtgaaggaagac
aggtgctgggagaaggtggaggtgtcctccaatccacaccgggccagcaagctgacggac
cgcaatcccaagacctactgggagtccaacggcagcactggctcccactccatcaccttg
cacatgcaccgtggtgttcttattaggcagctgaccttgcttgtggccagtgaggattca
agttacatgccagccagggtggtggtgtttgggggtgacagtgttggctgcatcagcacc
gaacttaacacggtgaatgtggtgccctctgccagccgggtgacactcctggagaacctc
agccgcttctggcccatcatccagatccgaataaagcgctgtcagcagggcggcatcgac
actcgagttcggggtgtggaggtgctgggccccaagcccaccttctggccattgttccgg
gagcaactctgccgacggacttgtctcttctacacaattcgggcacaagcatggagccgg
gacatagcagaggaccgccagcgcctccttcagctctatcctagactgaacagagtttta
cgccatgaacagaattttgcagatcgcttcctccctgatgatgaggctgcccaagcactg
ggcaaaacctgctgggaggcgctggtcagccccctggtgcagaacatcacctctcccgat
gcagggggtgtgagttccctgggatggctgctggaccagtacctggagcacagggagaaa
gcgaggagccgccagggtcaggcagcatcctttgcttctcaagttcggcgcttatgccac
ttgctggtacacgtggaagcccctcctgggccttctcctgagccgtcctcgcagcccctc
agcaagagcagtaagagtcaggacggaagcccggccccggcccccgtccgccccagcacc
acccttaggaacatcacccagtgctggctggcggtggtgcagggacaggccagcagattc
ctggcctcagcctggagggcctcggacttcgtgcctcgctactgtgatctctacgagcgc
ttgcaaagagccggctcagagctgttcgggccgcgggcagccttcaccctggccctgcgc
agcggcttctctggggctctgctgcagcagtccttcctcactgctgctcacataagtgag
cagtttgcgaggcacattgaccagcagatccagggtggtttgcttggtggagctgctggg
gtggaaatgctggggcggcttcagcggcacctggagcccatcatggtcctttctggccta
gagctggccactacttttgagcacttctatcagtactacatggctgacaggctcctgagc
ttgggctcgagctggctggagggggccgtgctggagcagattggcctctgcttccccaac
cgcctcccccagctgatgctgcagagcctgcgcacctcagaggagctgcagcgtgggttc
ctcctcttccagctccagcagctcgaccggcagctcttggagcagggggagcaggaggaa
tggaagctagagagactggaggaagaagacaggggacaggagactggaagagaactcctt
acagaagacccaggaccagccatttctgtcctggtcctgtcaccgcgctgctggccggtc
tccccactgtgctacctgcaccagcccaggaagcaccttcccacggagttctgtgatgcc
cttgacggcttctccagcttctacagccacagtcagcactacccagtcttggacatggga
ccacatcggcgacttcagtggacatggctgggccgggctgagctgcagtttggggaccag
accctgcatgtgtccactgtgcagatgtggctgctgctgaatttcaaccagacagaggag
gtgtcagtagagatcttgttgaggaactctggcctctcccctgagctcctgcaccaggcc
cttctgccgctcacctcagacagtggtcccttaacactggaggaggctcaggactttcca
caggggggggtgctgcggcttcgtgagcctaggtcccagacccatgaagaggtcctgtgg
ctgatacctccccagacgtatctcagtgtggaaaaggatgagggccgaaccttggagcag
aagaggaacctcttgagctgccttctcgtacggatactcaaagcccacggggagaaaggc
ctgcacatcgatcagctggtttgtctggttctggaggcctggcagaaggggccaaatcca
ccggggcgcctgggccgctctgctgcagtgggcgtggcctgttccagcactgacgtcctc
tcttgtatcctgcatctcctgggccagggctacgtggagcggagagatgaccgacctcag
gtcctgatgtatgccaccccagagcccatggggcactgccggggccaggcagatgtcccc
ttttgtggcaaccagagcacggagacctccaaacctagcccagaagctgtggtggccctg
gcctctctgcagctgccggcaggccggaccatgagtccccaggaggtagaaggattgatg
gagcagacagtgcggcaggtgcaggagacgctgaacttggagcccgatgtggctcagcac
cttctggcttattcccactggggcacggagcagctgctacaaagctacagcgaggatccc
gagccactgctgctcgccgcagggctgcgagtgccccagccccaggaggtgcccgctcgc
cctgaccagtgccccgtgtgcatcagccccctagggcccaatgacgactcgccctccctc
tgctgcctgcactgctgctgtaagtcttgctggaacgagtacctgacgactcggatagag
cagaactttgtgctgaactgtacctgccccatcgctgactgtcccgcccagcccacggga
gccttcatccgaaacattgtctcttccccagaggtcatctccaagtatgagaaggccctt
ctgcgaggttatgtggagagctgctccaacctgacatggtgcaccaaccctcagggctgc
gaccgtatcctgtgccgccagggcctgggcagtgggaccacctgctctaagtgcggctgg
gcctcttgcttcaactgtagttttcctgaggcgcactatcctgccagctgtggccacatg
tcccagtgggttgacgatggcggctactatgacggcatgagcgtggaggcccagagcaag
cacctggccaagctcatctccaaacgctgtcccagctgtcaggcgcctatcgagaagaat
gaggggtgtctacacatgacctgtgcaagatgtaaccatgggttctgctggcgctgcctc
aggtcctggaagccaagccacaaggactactacaactgctctgccatggtaagcaaagca
gctcgccaggagaagcggtttcaggactataacgagaggtgtaccttccaccaccaggcc
cgggagtttgctgtcaacctgcggaaccaggcctctgccatccatgaggtgcctccgccc
aaatccttcaccttcctgcaagacgcctgccgggccctcgagcaggctcgaaaggtgctg
gcctacgcctgtgtctatagcttctacagccagggcacggagtacatggatgtggtggag
cagcagacggagaacctggagctgcacacgaatgccctgcagatcctcctcgaggagacc
ttgctgcgctgccaggacctggcctcctccctgcgcctcctgcgggctgactgcctcagc
acaggcacggagctgctccggaggatccaggagaggctgctggccatcctacagcactcg
acccaggacttccgggtcgggctgcagagtccctcagtagagacccgggaggtgaaaggg
tccaacgtgcccagtgaccagccccagggctcctcaggactggaagtggaagacgaggag
gaagaagaggaagaggaggaggaggaggatgtacctgagtggcagcacgagtttgatgag
gaactagacaatgacagcttctcctacgatgaggagtctgagaacctggaccgagagacc
ttcttctttggcgatgaagatgacgatgatgagtcctatgactga

DBGET integrated database retrieval system