KEGG   Rattus norvegicus (rat): 316256Help
Entry
316256            CDS       T01003                                 

Gene name
Tnfrsf21
Definition
(RefSeq) TNF receptor superfamily member 21
  KO
K05157  tumor necrosis factor receptor superfamily member 21
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    316256 (Tnfrsf21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    316256 (Tnfrsf21)
   04090 CD molecules [BR:rno04090]
    316256 (Tnfrsf21)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   316256 (Tnfrsf21)
CD molecules [BR:rno04090]
 Proteins
  316256 (Tnfrsf21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death Ephrin_rec_like CARD FlhC
Motif
Other DBs
NCBI-GeneID: 316256
NCBI-ProteinID: NP_001101677
RGD: 1307308
Ensembl: ENSRNOG00000011517
UniProt: D3ZF92
Position
9q13
AA seq 655 aa AA seqDB search
MGTSASSITALASCSRIAGQVGATMVAGSLLLLGFLSTITAQPEQKTLSLTGTYRHVDRT
TGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPSGTFTRHENGIERCHDCSQPCPRPMIER
LPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVP
SSVMKCRAHTDCLGQNLMVVKQGTKETDNVCGVHLSSSSTTPSSPGIATFSHPEHTESHD
VPSSTYEPQGMNSTDSNSTASVRTKVPSDIQEETVPDNTSSTSGKESTNRTLPNPPQLTH
QQGPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNPHKHFDINEHLPWMIVLFLLL
VLVLIVVCSIRKSSRTLKKGPRQDPSAIMEKAGLKKSLTPTQNREKWIYYRNGHGIDILK
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLIS
ALRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNVKLENSTLLTVEP
SPLDKNKGFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIF
DDMLHILNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggggacctccgcaagcagcatcaccgccctcgcctcttgcagccgcatcgccggccaa
gttggagccacgatggtcgccggctcccttctcttgcttgggttcctcagcaccatcaca
gcccaaccagaacaaaagactctgagtctcacgggcacgtaccgccacgttgaccgtacc
actggccaggtgctaacctgcgacaagtgtccggcaggaacgtatgtctccgagcactgt
accaacacgagcctgcgagtctgcagcagctgcccctcggggacctttaccaggcatgag
aacggcatagagagatgccatgactgtagtcagccatgcccacggccgatgattgagaga
ttaccttgtgctgccttgactgaccgagaatgcatctgcccacccggaatgtatcagtct
aatgggacctgcgctccccacacggtgtgccccgtgggctggggtgtgaggaagaaaggg
acagagaatgaagatgtgcggtgtaagcagtgtgctcgcggtaccttctctgacgtgcct
tccagtgtgatgaagtgtagagcccacacggactgtctgggtcagaacctgatggtggtc
aagcaggggactaaggagacagacaacgtctgtggcgtgcacctgtcctcctccagcacg
accccatcttcccctggcatagctaccttttctcatcctgagcacacggaatcccacgat
gtcccctcctccacctatgagccccaaggcatgaactcaacagattccaactctactgcc
tctgttagaactaaggtaccaagtgacatccaggaagagacagtgcctgacaatacaagc
tccacgagtgggaaggagagcacgaacaggaccctgccaaacccaccacaacttacccac
cagcaaggcccccaccacagacacattctgaagctgctgccatcatccatggaggccact
ggtgagaagtccagcacagccatcaaggcccccaagaggggccatcccagacagaaccca
cacaagcatttcgacatcaacgagcatttgccctggatgattgtactcttccttctgctg
gtcctggtgctcattgtggtgtgcagtatccgaaagagctctaggactctcaagaagggg
ccccggcaggatcccagtgccatcatggaaaaggcagggctgaagaagtccttgactcca
acccagaaccgggagaaatggatctactaccgcaatggccacggtattgacatcctgaag
cttgtagcagcgcaggtgggaagccagtggaaggacatctatcagtttctttgcaacgcc
agcgagagggaggtggctgccttctccaatggatacactgcagaccatgaacgagcctat
gcagctctgcagcactggaccatccggggccctgaggccagccttgctcagctcatcagc
gccttgcgccagcaccgacgcaatgatgttgtggagaagattcgtgggctgatggaagat
actacgcagttggaaaccgacaaactggctctccccatgagccccagtccgcttagcccg
agccccattcccagtcctaacgtgaaacttgagaattccactctcctgacagtggagccc
tcacccctggacaagaacaagggcttcttcgtggacgagtcggagccccttctgcgttgt
gactccacgtccagcggctcttcagcactgagcaggaatggctcctttataaccaaagaa
aagaaggacacagtgttgcggcaggtccgcctggacccctgtgacttgcagcccatcttt
gacgacatgctgcacatcctgaatccggaagagctgcgggtaatcgaagagattccccag
gctgaggacaaactggaccgtctcttcgagatcattggggtcaagagccaagaagccagc
cagaccctcttggactctgtgtacagccatcttcctgacctattgtag

DBGET integrated database retrieval system