KEGG   Rattus norvegicus (rat): 316258Help
Entry
316258            CDS       T01003                                 

Gene name
Cd2ap, CMS
Definition
(RefSeq) CD2-associated protein
  KO
K13738  CD2-associated protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    316258 (Cd2ap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    316258 (Cd2ap)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    316258 (Cd2ap)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    316258 (Cd2ap)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   316258 (Cd2ap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_9 SH3_1 SH3_2 Tmemb_cc2 Helo_like_N Spc29
Motif
Other DBs
NCBI-GeneID: 316258
NCBI-ProteinID: NP_852140
RGD: 727803
Ensembl: ENSRNOG00000011987
UniProt: Q80ZE7
Position
9q13
AA seq 637 aa AA seqDB search
MVDYIVEYDYGAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE
TEPKDDNLPIKRERPGNVASLVQRISTYGLPAGGIQPHPQTKAMKKKTKKRQCKVLFEYS
PQNEDELELTVGDVIDVIKEVEEGWWSGTLNNKLGLFPSNFVKELESTDDGEMHDAQEES
EVSLTGPTSPMPSPGNGSEPAPGSVTQPKKIRGVGFGDIFEQGSVKLRTRTSSSETEEKK
SEKPLILQSLGSRTQNVEVTKPDIDGKIKAKEYCKTVFPYTGTNEDELTFREGEIIHLIS
KETGEAGWWKGELNGKEGVFPDNFAVQISELDKDFPKPKKPPPPAKGPAPKPDPLAGEKK
TFPLKAEDRDEKSLLEQKPSKPAAPQVPPKKPTPPTKANNLLRSPGTMYPKRPEKPVPPP
PPTAKINGEVSTISSKIDTEPLSKPKLDPEQLPVRPKSVDLDALVARNSKETDNVNFDDI
ASSENLLHLTANRPKMPGRRLPGRFNGGHSPTQSPEKTLKLPKDDDSGNIKPSEFKKDAG
YSSKPSLSAPSSASKVNTAAFLSPLELKAKVEADDGTKSSLDELRAQITELLCIVDALKK
DHGKELEKLRRELEEEKAMRSNLEVEIAKLKKAVLLS
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggttgactatattgtggagtatgactacggtgctgtacatgatgatgagttaactatc
cgagttggggaaatcatccgaaatgtgaaaaaactacaggaagaaggatggctagaagga
gaactaaatgggagacgagggatgttccctgacaattttgttaaggaaattaaaagagag
acagaacccaaggatgacaatttgcccattaaacgggaaaggcctggaaatgtcgcgagt
ctggtccagcgaatcagcacctacggacttccagctggagggattcagccacacccacaa
accaaagctatgaagaagaagacaaaaaagcgtcagtgtaaagttctttttgagtactct
ccacaaaatgaagacgaactggaactgaccgtgggggatgtcattgatgtcattaaagag
gtagaagaaggctggtggagtggaaccctgaacaataagttgggactgtttccctcaaac
tttgtgaaagaattagagtccacagatgatggtgaaatgcacgacgctcaggaggaatca
gaagtttctttgactggccctacctcacctatgccatctccggggaatgggagtgaacca
gctcctggatcagttacacagccaaagaagatccgaggagttggatttggagacattttt
gaacaaggctctgtgaaacttaggacaagaacttccagtagtgaaacagaggagaagaaa
tcagaaaagcctttaattctacagtcactgggctctagaacccagaatgtggaggtaaca
aaaccagacatagatggcaagattaaagctaaggaatattgcaaaacagtatttccctat
acaggaaccaatgaagatgaacttacgtttagagaaggggagataatccatttgataagt
aaggagactggagaagcaggctggtggaaaggtgaactgaatggtaaagaaggagtgttt
ccagataactttgctgttcagataagtgaactagataaagactttccaaaaccaaagaaa
ccacctcctcctgcaaaaggtccagctccaaaacctgacccgttagctggagagaagaag
acctttcctctgaaggcggaagacagagatgaaaaatcactgctagaacagaaaccttct
aaaccagctgctcctcaagtcccacccaaaaagcctactccacctaccaaagccaataat
ttactgaggtctcctggaacaatgtacccaaagcggccggaaaagccagttcctcctcca
cctccaacagccaaaattaatggagaagtatctacaatttcttcaaagatcgatactgag
cccttatcaaaaccaaagctagatcctgaacaattgcccgttagaccaaagtcagtagac
cttgatgccttggtagccaggaactcaaaagaaacagataatgtaaattttgatgacata
gcttcctcagagaacttgttacatctcactgcaaatagacccaagatgcctggaagaaga
ttgcctggccgcttcaatggtggacattctccaacccagagcccagaaaaaaccttgaag
ctcccaaaagatgatgatagtggcaacataaagccgtcggagtttaagaaggatgcaggc
tactcttcaaagccatctctttcagcaccttcaagtgcttctaaagtaaatacagctgct
ttcctaagtccattagagctcaaagctaaagtagaagccgatgatgggacaaaaagctcc
ctggatgaacttagagcccagattactgaattactgtgcattgtagatgcactgaaaaag
gatcatgggaaagaactggaaaagctacgcagagaactagaagaagagaaggccatgcga
agtaacctagaggtggaaatagcaaagctcaagaaagctgttctgttgtcttga

DBGET integrated database retrieval system