KEGG   Rattus norvegicus (rat): 316259Help
Entry
316259            CDS       T01003                                 

Gene name
Opn5, Gpr136
Definition
(RefSeq) opsin 5
  KO
K08385  G0-opsin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    316259 (Opn5)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Vision
   Opsin
    316259 (Opn5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 316259
NCBI-ProteinID: NP_861437
RGD: 727869
Ensembl: ENSRNOG00000012689
UniProt: Q7TQN6
Position
9q13
AA seq 534 aa AA seqDB search
MALNHTALPQDERLPHYLRDEDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSR
RKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWFGCRWYGWAGFFFGCGS
LITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAVIWAYASFWTTMPLVGLGDYAPEPFG
TSCTLDWWLAQASGGGQVFILSILFFCLLLPTAVIVFSYAKIIAKVKSSSKEVAHFDSRI
HSSHVLEVKLTKGLVRADSSPESLPRSVFSTAEPINCHVLSISHSRVSTVAMLICAGFLI
AWIPYAVVSVWSAFGRPNSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYRFACCQTGGLRA
TKKKSLEDFSDLNQILKRNSSTKSGQIGNKDTAEEHDRGTMQVIGEGEEGTMESTSNSLV
PSFHSALKGFHLTQLLANTLSINTSNFRAVEKPFLAPRLLSLLLYWDAGEDGLTLADMHL
KNVVVLSNRAVPDLLVPMLWMERVTVMTVTVARNKHLCSEAEKPRSCPSGLQKY
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccttgaaccacactgccctgcctcaggatgagcgcctgccccactatcttcgagac
gaggacccctttgcttccaaactttcctgggaagcggatttggtggctggcttttaccta
acaataatcgggattctctccacatttggaaatgggtatgtcctttatatgtcttctaga
cgcaagaagaagctgagacctgcggaaataatgactattaatttagcagtctgtgatctg
gggatttcagttgtaggcaagccattcaccatcatctcttgcttctgccaccgctgggtg
tttggctggtttggctgccgctggtatggatgggctggatttttctttggctgtggaagc
ctgattaccatgactgctgtcagcctggaccgctatctgaagatctgttatctgtcttat
ggggtctggctgaagagaaagcatgcctacatctgcctggcagtcatctgggcttatgct
tccttctggaccaccatgcccttggtgggcctgggggactatgcacctgagcccttcgga
acctcgtgcaccctggactggtggctggcccaggcttcgggtgggggtcaggtattcatc
ctgagcatcctcttcttctgcctcctgctgccaacggctgtgattgttttctcatacgcg
aagatcattgccaaggtgaaatcttcttctaaagaggtagcacatttcgacagtcggatt
catagcagccatgtgctcgaggtgaagctgaccaagggtctagtgagagcagattcaagc
ccagagtccttacccaggtcggtgttttctacagcagaaccaatcaactgccatgttttg
agtatctcccattccagagtctcaactgtggcgatgctgatttgtgctggtttcctcatt
gcctggattccttacgcggtagtctccgtgtggtcagcttttggaaggccgaactccatc
cctatacagctctccgtggtgcccacgctcctcgcaaaatctgcagcgatgtacaaccca
atcatctaccaggtcattgattacagatttgcctgttgccagactggtggtttgagagca
acaaagaagaagtctttggaagactttagtgacttgaaccagattctgaagaggaatagt
tccactaagtcagggcaaataggaaacaaagacacagctgaggagcatgaccgaggaacc
atgcaggtgataggggagggagaggaaggaacaatggagtccacatccaacagtttagtg
ccttcgtttcattcagcattgaagggatttcatttaacacagctcttagctaacacttta
tcaatcaatacaagtaattttcgagcggtagaaaaaccattcttagcaccgaggctgctg
tcgctgctgctgtactgggatgctggtgaagacggcctgacattagcagacatgcacctc
aaaaatgttgttgttctctcaaacagagcagttccagatttactagtgcccatgttatgg
atggagagagtcaccgtaatgacggtgactgtggcaagaaataagcatctgtgttctgag
gccgagaaaccccgcagctgtccatcagggcttcagaaatattga

DBGET integrated database retrieval system