KEGG   Rattus norvegicus (rat): 316325Help
Entry
316325            CDS       T01003                                 

Gene name
Hs6st1
Definition
(RefSeq) heparan sulfate 6-O-sulfotransferase 1
  KO
K02514  heparan sulfate 6-O-sulfotransferase HS6ST1 [EC:2.8.2.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    316325 (Hs6st1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    316325 (Hs6st1)
Enzymes [BR:rno01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     316325 (Hs6st1)
Glycosyltransferases [BR:rno01003]
 Unclassified
  Sulfotransferases
   316325 (Hs6st1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_2
Motif
Other DBs
NCBI-GeneID: 316325
NCBI-ProteinID: NP_001101680
RGD: 1309218
Ensembl: ENSRNOG00000014516
UniProt: D4A6E6
Position
9q21
AA seq 329 aa AA seqDB search
MKGDDVIVFLHIQKTGGTTFGRHLVQNVRLEVPCDCRPGQKKCTCYRPNRRETWLFSRFS
TGWSCGLHADWTELTNCVPGVLDRRDPAGLRSPRKFYYITLLRDPVSRYLSEWRHVQRGA
TWKTSLHMCDGRTPTPEELPPCYEGTDWSGCTLQEFMDCPYNLANNRQVRMLADLSLVGC
YNLSFIPESKRAQLLLESAKKNLRGMAFFGLTEFQRKTQYLFERTFNLKFIRPFMQYNST
RAGGVEVDEDTIRHIEELNDLDMQLYDYAKDLFQQRYQYKRQLERREQRLRNREERLLHR
SKEALPREDTEEPGRVPTEDYMSHIIEKW
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgacgacgtgatagtcttcctgcatatccagaagaccggcggcaccaccttc
ggccgccacctagtgcagaacgtgcgcctcgaggtgccctgcgactgtcgcccgggccag
aagaagtgcacctgctatcggcccaatcgccgcgagacctggctcttctctcgcttctcc
accggctggagctgcgggctgcacgctgactggaccgaactcaccaactgtgttcccggt
gtgctagaccgccgcgacccagcaggtctgcgttcgcccagaaagttctactacatcacc
ctgctgcgagaccctgtatcccgctacctgagtgaatggcgacatgtacagcgtggggcc
acgtggaagacctccttgcacatgtgtgacgggcgcacaccgaccccagaggagctgcca
ccctgctacgagggcacagactggtcgggctgcacattgcaggagttcatggattgcccc
tacaacctggccaacaaccggcaggtgcgcatgctggctgacctcagcctggtgggctgc
tacaacctgtctttcatccccgagagcaagcgggcccagctgctgctggagagcgccaag
aagaacctgcgcggcatggccttcttcggcctcacggagttccagcgcaagacgcagtac
ctatttgagcggacgttcaacctcaagttcatccggcccttcatgcagtacaacagcacg
cgggcgggcggtgtggaggtggatgaggacactatccggcacatcgaggagctcaacgac
ctggacatgcagctttatgactatgccaaggacctcttccagcagcgttaccagtacaag
agacagctggagcgcagggagcagcgcctgcgcaatcgcgaagagcgcctcctgcatcgc
tccaaggaagcgctgccacgggaggacacggaagagccaggccgagtacccaccgaggac
tacatgagccatatcattgagaagtggtag

DBGET integrated database retrieval system