KEGG   Rattus norvegicus (rat): 316327
Entry
316327            CDS       T01003                                 

Gene name
Arid5a
Definition
(RefSeq) AT-rich interaction domain 5A
Organism
rno  Rattus norvegicus (rat)
SSDB
Other DBs
NCBI-GeneID: 316327
NCBI-ProteinID: NP_001030106
RGD: 1311041
Ensembl: ENSRNOG00000015382
UniProt: Q3KRC8
Position
9q21
AA seq 431 aa
MAKELRGDDGATEKLKKAKDSEERQADQTTSEKTKSDAPGQTQLPRQGSSRDSTEQLGPV
SGSSPPFLGANSCPEAYKRLLASFYCKGAHGIMSPLAKKKLLAQVSKAEALQCQEEGCRH
GARSPNKDLQESSQNPRGLAENSEHQLTPPEGLRAPGGSTGVEAQVGPCPTAPTFLGRFH
AYPTEVLKPVSQHPRDFFSSLKDRVLLGPPGKEEGLTAKESQLVWGGDANRPSAFHKGST
RKRSFYPKPKACWVSPMAKVPAESPGAPLPHPRSPGLSKKRGLEEEGYTHGGKKLKAVSP
FLKEVDARESEGKPAAPGLAVSCLLGPALGPTPPESYRGTMLRCPLNFTSSADPLKGQAS
LPFSPLVIPTFPAHLLATTGPSPMATSLMHFPPTPYDTVLRNRLGPASSAWHVPPVTTYA
APHFFHLNTKL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggccaaggagctgaggggagatgatggggccactgagaagctgaagaaggccaaggac
tcagaggagaggcaggcggaccagaccacatcagaaaagaccaaatcagatgcccctggc
cagacacagcttcccagacaaggatcctcaagggatagcacggaacagctgggcccagta
tctgggtcttctccaccgttcctgggtgctaatagttgtcctgaggcctacaagcggctt
ttggcgagcttctactgcaaaggggcgcatggtatcatgtcaccactggccaaaaagaaa
ctcctggctcaggtcagcaaggcagaggccttgcagtgccaagaagagggctgtcgccac
ggagcaaggagccccaacaaggaccttcaagaaagttcccagaacccaagagggctggct
gagaactctgaacaccaactaacccccccggaaggattgcgggcccctggtggcagcact
ggtgtggaggcacaggtgggcccctgccctacagcccccacattcttaggccgttttcat
gcgtaccccaccgaggtgctgaagcccgtcagccagcaccccagggacttcttctccagc
cttaaagacagggtgctgttgggaccacctggtaaagaggaagggctgacagccaaagag
tcccagctggtatggggtggggatgccaaccgcccctctgcattccacaaaggcagcaca
aggaaaagaagtttctatcccaagcccaaagcctgctgggtgtcccccatggccaaggtc
cctgctgagagtcccggagccccactcccccatcccaggagcccaggtcttagcaagaag
cgcggcttggaagaagagggatacactcatggtggcaagaaactgaaggcggtgtctccc
tttctgaaggaggtggatgccagggagagtgagggcaagcctgcagcccctggcttggct
gtatcctgtctactgggcccagccctggggcccactcctccagagtcctacaggggcacc
atgctgcggtgtcctctgaacttcaccagtagtgcagaccctctgaagggccaggcctca
ctgcccttcagccccctggtcattcctactttcccagcccatctcctggctacaacaggc
ccctcgcctatggctaccagcctgatgcatttccctcccacgccatatgacactgtcctt
cgcaacagactgggtccagcttcgtctgcctggcacgtgccccccgtcacaacctatgcg
gcaccccacttcttccacctcaacaccaaactgtag

DBGET integrated database retrieval system