KEGG   Rattus norvegicus (rat): 316351
Entry
316351            CDS       T01003                                 

Gene name
Npas2
Definition
(RefSeq) neuronal PAS domain-containing protein 2
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    316351 (Npas2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    316351 (Npas2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    316351 (Npas2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 316351
NCBI-ProteinID: NP_001101684
RGD: 1309681
Ensembl: ENSRNOG00000013408
UniProt: F1MAG2
Position
9
AA seq 816 aa
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKLDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFVIVVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEFLKSDNDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
MCVADEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPTEAMHPSALKEKDSSLEPQPHFNALDMGASGLTSSPSPSASSRSSHKSSH
TAMSEPTSTPTKLMAENSTTALPRSATLPQELPVQGLSQAATMPAPLLSSSSCDLAKQLL
PQSLPQTVLQSPPAPVTQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCL
VQDSNVQMFLQQPAVSLSFSGAQRPAAQQPLQQRPSAPSQPPLVVNTPLPGQITSTQVTN
QHLLRESNVMSAQGPKPIRSSQLLPASSRSLSSLPSQFSSTASVLPPGLSLTTVAPTPQD
TSQCQPSPDFGHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQVTFPSPD
SHPTSSSAPTPVLLMGQAVLHPGFPASQPSPLQPTQVQQQPPPYLQAPTSLHSEQPDSLL
LSTFSQQPAPLGYAATQPTQPQPPRPSRRVSRLSES
NT seq 2451 nt   +upstreamnt  +downstreamnt
atggacgaagatgagaaggatagagcaaagagagcctctcgaaacaagtctgagaagaag
cgtcgggaccagttcaatgttctcatcaaagagctcagctccatgctcccaggcaacact
cggaaactggacaaaacaactgtgctggagaaggtcatcggatttctgcagaaacacaat
gaagtctcagcacaaacagaaatctgtgacatccagcaggactggaagccttcattcctc
agtaacgaagaattcacccagctgatgttggaggcgttagatggcttcgtcattgttgtg
acaacggacggcagcatcatctatgtgtccgacagcatcacgcctctcctcggacattta
ccgtcggatgtcatggatcagaacttgttaaatttccttccagaacaagaacattccgaa
gtttataaaatcctttcctcccatatgcttgtgacggattccccctccccagaattccta
aaatctgacaacgatttagagttttattgtcatcttctgagaggcagcttgaacccaaag
gaatttccaacttacgaatacataaaatttgtaggaaattttcgctcttacaacaatgtg
cctagcccctcctgtaatggctttgacaacaccctttcaagaccctgccgcgtgcccctg
gggaaggaggtctgcttcatcgccacggtgcgcctggcaacaccacagttcttaaaggaa
atgtgtgtagctgacgaacctttagaggaattcacttcgaggcatagcttggaatggaaa
tttttatttctggatcacagagcccctccaatcataggatacctgccctttgaagtactt
ggcacgtcaggctatgactactaccacattgatgacctggagctcctggccaggtgccac
cagcacttgatgcagtttggcaaagggaagtcgtgttgttaccggtttctaaccaaagga
cagcagtggatttggttgcaaacccactactacatcacctaccaccagtggaactccaag
cccgagttcatcgtgtgcacacactcggtggtcagttacgcagatgtccgagtggaaagg
agacaggagctggctctggaagatccacccacagaagccatgcacccctctgcactgaag
gaaaaggactcaagcctagagcctcagccgcactttaatgcacttgacatgggtgcctca
ggtcttaccagcagtccttcgccatcagcatcctcgaggagttcccacaagtcctcacac
acagccatgtcagaacccacctccactccaaccaagctgatggctgagaacagcaccaca
gctttgccaagatcagccaccctaccccaggagttaccagtgcaggggctcagccaggca
gccacaatgccagctcctctgctttcctcatcatcctgtgaccttgccaagcagctcctg
cctcagtccctgcctcagacggtcctgcagagtccacctgctccagtgacacagttttca
gcacaatttagcatgttccagaccataaaagaccagttggagcagaggacacggatcctg
caggccaacattcggtggcagcaggaagagcttcacaagatccaggaacaactctgcctg
gtccaggactccaacgtccagatgtttctacagcagccagcggtgtctctgagcttcagc
ggtgcccagagaccggcagctcagcagccactgcaacaaaggccatctgcaccgtctcag
cccccgcttgtggtcaacactccactgccggggcagatcacatccacccaagtcacaaac
cagcacctgctcagagaatcgaatgtgatgtccgcccagggtccaaaaccaataagaagc
tcccagttgctgcctgccagcagccgttcactgagcagcctgccgtcccagttcagcagc
acagcgtccgtgctcccaccaggcctgagcctcaccactgtcgctcccacccctcaggac
accagccagtgccagcccagccctgacttcggccatgatcggcagctcaggctgttgctg
agccaacccatccagcctatgatgcctgggtcttgtgatgccaggcagccctcagaagtc
agcaggactggacggcaagtcaaatatgcacagagccaagtgacgtttccaagtcctgac
tcccaccccaccagcagcagcgcccccaccccggtcctgttgatggggcaggccgtgctc
catcccggcttccccgcatcccagccatcacccctgcaaccaacacaggtacaacagcag
ccaccaccctatctacaggcaccaacatctctgcacagtgaacagccggactcgctcctt
ctctccaccttctcccagcagccagcacctctgggctatgcagccacacagcctacacag
ccgcaacccccacgcccttcccgcagggtcagccggctgtcagagtcctaa

KEGG   Rattus norvegicus (rat): 60447
Entry
60447             CDS       T01003                                 

Gene name
Clock
Definition
(RefSeq) circadian locomoter output cycles protein kaput isoform 1
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
rno04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    60447 (Clock)
  09159 Environmental adaptation
   04710 Circadian rhythm
    60447 (Clock)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    60447 (Clock)
   03036 Chromosome and associated proteins [BR:rno03036]
    60447 (Clock)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     60447 (Clock)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    60447 (Clock)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    60447 (Clock)
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9 DUF6080
Other DBs
NCBI-GeneID: 60447
NCBI-ProteinID: NP_068628
RGD: 620271
Ensembl: ENSRNOG00000002175
UniProt: Q9WVS9
Position
14
AA seq 863 aa
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSVVYVSETVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEDLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLNSVSTSTHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLESLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRPHLPAHEKMTQRRSSF
SSQSINSQSVGSSLTQPAMSQAANLPIPQGMSQFQLSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNIQQLTPINMQGQV
VPVNQIQSGVNAGHVSTGQHMIQQQTLQSTSTQSQQSVMSGHSQPTSLPNQTPSTLTAPL
YNTMVISQPAAGSMVPIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACG
AVMVPSTMLMGQVVTAYPTFATQQQQAQALSVTQQQQQQQQQQQQQQQQQPQQAQPQPQS
QQSSQDQPHPSVQQPAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQ
HQQQQLHRHRTDSLTDPSKVQPQ
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcaattgttgacagagatgacagtagt
atttttgatggattggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatcagaaaagaaacgtagagatcagttcaatgtactcattaaggaactggggtctatg
cttcctggtaatgctagaaagatggacaagtctactgttctacagaagagcattgatttt
ttacgcaaacataaagagatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcgatcatgacagatggaagtgtagtatatgtatctgagacggtaacttcg
ttacttgaacacttaccatctgatcttgtggatcaaagtatatttaattttatcccagag
ggagaacattcagaggtttataagatactatctactcacctgctggaaagtgactcctta
acccccgaggacttaaaatcaaaaaatcagttagaattctgttgtcacatgcttcgagga
acaatagacccaaaggagccatccacctatgaatatgtgagatttataggaaattttaaa
tctttaaacagtgtatcaacttcaacacataatggtttcgaaggaactatacagcgcaca
cacaggccttcttatgaagatagagtttgtttcgtagctactgtcagattagctacccct
cagttcatcaaggaaatgtgtactgttgaagaaccgaatgaagagttcacatctagacac
agtttagaatggaagtttctatttctagatcacagggcgccgccaatcataggctatctg
ccgtttgaagtcctgggaacatcaggctatgattactatcatgtggacgacctagaaagt
ctggcaaaatgtcatgagcacttaatgcaatatggaaaaggcaaatcatgttactatagg
ttcttgaccaaaggacagcagtggatttggcttcagactcattactatatcacttaccat
cagtggaactcaaggccagagttcatcgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacggcgagaacttggcattgaggagtctcttcccgagacagctgct
gacaaaagccaagattctgggtctgacaatcgtataaacacagtgagtctcaaggaagca
ctggaaaggttcgatcacagcccaactccttctgcctcctccagaagctcaagaaagtcc
tcgcacacagcagtctcagacccttcctcaacgccgacaaagatccccactgatactagc
actcctcccagaccgcacctgccagctcatgagaagatgacacagcggaggtcatccttc
agtagtcagtccataaactcccagtcagttggttcatcattaacacagccagcgatgtct
caagctgcaaatttaccaatcccacaaggcatgtcacagtttcagctttcagctcagtta
ggagccatgcagcatctcaaagaccagctagagcagcggacacgcatgatagaagcaaat
attcatcggcagcaagaagaactaaggaaaattcaagaacaacttcaaatggtccatggt
caagggctacagatgtttttgcagcaatcaaaccctggactgaattttggttctgttcaa
ctttcctctggaaattccaatatccagcaactcacacctataaatatgcaaggccaagtt
gtccctgttaaccagattcagagtggggtgaatgctggccatgtcagcacaggccagcac
atgatccagcagcagactttacaaagtacatcaactcagagtcaacagagtgtaatgagt
ggacacagtcagccaacgtctcttccaaaccagacgccgagcactctgacagccccactg
tacaatacgatggtgatctctcagcctgcagctgggagcatggtcccgattccatccagt
atgccgcagaacagcacccagagtgctacagtcaccacgttcactcaggacagacagata
aggttttctcaaggtcagcaacttgtgaccaaattagtgactgctcctgtagcttgtggg
gccgtcatggtgccaagtaccatgcttatgggtcaggtagtgactgcctatcctaccttt
gccacacaacagcagcaggcacaggccttgtcagtaacacagcaacagcagcagcagcag
cagcagcagcaacagcagcagcagcagcagccgcagcaggcgcagccgcagccccagtca
cagcagagttcccaggaccagccgcatccttcagttcagcagccagctcagctgacccag
ccaccacaacagttcttacagacatctcggttgctccatgggaatccttcgacacagctc
atcctctccgctgcctttccactacaacagagcactttccctccttcgcaccaccagcaa
caccagcaacagcagctccatcggcacaggactgacagcctgactgacccttccaaggtc
cagccacagtag

DBGET integrated database retrieval system