KEGG   Rattus norvegicus (rat): 316395Help
Entry
316395            CDS       T01003                                 

Gene name
Hecw2
Definition
(RefSeq) HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2
  KO
K12168  E3 ubiquitin-protein ligase HECW2 [EC:2.3.2.26]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    316395 (Hecw2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     316395 (Hecw2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  HECT type E3
   316395 (Hecw2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT HECW_N HECW1_helix WW C2 Cep57_CLD RFXA_RFXANK_bdg
Motif
Other DBs
NCBI-GeneID: 316395
NCBI-ProteinID: NP_001101688
RGD: 1593244
Ensembl: ENSRNOG00000013257
UniProt: D4ADD3
Position
9q31
AA seq 1578 aa AA seqDB search
MASSAREHLLFVRRRNPQMRYTLSPENLQSLATQNSMPENMALQRANSDTDLVTSESRSS
LTASMYEYTLGQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPANFWDSKNRGVTGTQKGQ
IVWRIEPGPYFMEPEIKICFKYYHGISGALRATTPCITVKNPAVMMGAEGMEGCASGSLH
SRKLVSFTLSDLRAVGLKKGMFFNPDPYLKMSIQPGKKSSFPTCAHHGQERRSTIISNTT
NPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGKLTIPVQRLLERQAVGDQMLS
YNLGRRLPADHVSGYLQFRVEVPSSAQEDASPEAVGTILGVHTVNGDLGSPSDDEDMPGS
HHDSTICANGPVSEDSVADGTPKHSFRTSSTLEIDTEDLISTSSRNSPPRGRQDSLNDYL
DAIEHNGPSRPGTASSSERPMGASPKLRSSFPTDTRLNAMLHIDSDEEDHDFQQDLGYPS
SLEEEGGLIMCSRTSRIDDGSLTSQTKPEDDNPVENEDASVHETASLEERPENLPEVEDG
SLPSGTAPDENEASVEPQPSADQGSTELCSSQEVDQPTSGTDAGASDTSVGSRRAASETE
SLDQGSEPSQVSSETEPSDPARTESVSEASTRPEGESDLEGADSSCNESVTTQLSSVETR
CSSLESARFPETPAFSSQEEEDGACAAEPTSSGPTEGSQESVCTPGSLPAVQVPSREEEG
SGAEATALSEQGELGEVWQRRGSLEGAAAAATAAATDSQPQEDGDPGDTQGACEGATAQE
EGATGGSQTNGHQPLRSLPSVRQDVSRYQRVDEALPPNWEARIDSHGRIFYVDHVNRTTT
WQRPTAPPAPQVLQRSNSIQQMEQLNRRYQSIRRTMTNERPEENTSAIDGAGEEADFHQA
SADFRRENVLPHSTSRSRLTLLLQSPPVKFLISPEFFTVLHSNPSAYRMFTNNTCLKHMI
TKVRRDTHHFERYQHNRDLVGFLNMFANKQLELPRGWEMKHDHQGKAFFVDHNSRTTTFI
DPRLPLQSSRPTSALVHRQHLTRQRSHSAGEVGEDSRHAGPPVLPRPASTFNTVSRPQYQ
DMVPVAYNDKIVAFLRQPNILEILQERQPDLARNHSLREKIQFIRTEGTPGLVRLSSDAD
LVMLLSLFEEEIMSYVPPHALLHPSYCQSPRGSPVSSPQNSPGTQRANARAPAPYKRDFE
AKLRNFYRKLETKGYGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVGEE
GLDYSGPSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHEWFRFSGRIL
GLALIHQYLLDAFFTRPFYKALLRILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDLTFT
VNEEVFGQITERELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVD
ARLVSVFDARELELVIAGTAEIDLNDWRNNTEYRGGYHDNHIVIRWFWAAVERFNNEQRL
RLLQFVTGTSSIPYEGFASLRGSNGPRRFCVEKWGKITALPRAHTCFNRLDLPPYPSFSM
LYEKLLTAVEETSTFGLE
NT seq 4737 nt NT seq  +upstreamnt  +downstreamnt
atggcaagctcagcccgggagcatttgctttttgtgcggcgtcgaaatccacagatgcgg
tacacactgagcccagagaaccttcagagcctcgcaacccagaactcaatgcccgagaac
atggccctgcagcgagccaacagtgacaccgacctcgtgacctccgagagccgctccagc
ctgactgccagcatgtatgagtacacactggggcaagcccagaacctcattatcttctgg
gacattaaggaagaggttgaccccagcgattggatcggactctatcacatagacgagaat
tctccagccaacttctgggattctaaaaacaggggcgtgactggaacccaaaaaggacaa
attgtatggcggattgagcccgggccctacttcatggaaccggagatcaaaatctgtttc
aaatactaccatggcattagcggagccctgcgagccacaaccccctgtattactgtgaag
aacccggctgtgatgatgggtgcagaaggcatggaaggatgtgcttcaggaagcctgcac
tctaggaaactcgtcagcttcacattgtcagatctcagggcagttgggctcaagaaaggg
atgttcttcaatcctgacccttatcttaagatgtccattcagccagggaagaagagcagt
ttccctacctgtgcccaccacgggcaggagagaagatccactatcatcagtaacaccacc
aatccaatctggcacagagagaaatactccttttttgcacttttgaccgatgtcttagaa
attgaaatcaaagacaaatttgccaagagccggcccatcatcaaacgcttcctgggaaaa
ttaaccattccagtgcagaggctgttggagaggcaggctgtcggtgaccagatgctcagc
tacaaccttggcagaaggctccccgctgatcacgtgagtggctacctccagtttagagtg
gaagtcccatcctctgcccaggaagatgcatctccagaggccgttggcaccatcctcggt
gtccacactgtgaatggagacctgggcagcccttctgatgatgaggacatgccagggagc
catcatgacagcaccatttgtgctaacgggccagtgtctgaggacagtgttgctgacgga
acccccaagcattctttcaggactagctctaccctggagattgacacagaggacttgatc
tctacttcttcaagaaattcaccccccaggggccgccaggattcactcaatgattactta
gatgctattgaacacaatggcccctctaggccagggacagcctcctcctctgagcggccc
atgggagcctctcccaaactgaggagtagttttcccactgacaccagactcaatgcgatg
cttcatatagactcagatgaagaagaccatgattttcagcaagacctaggctacccatcc
tccttggaggaggaaggaggcctgatcatgtgcagcaggacatcgaggatcgatgatggg
agcctgacgtctcagaccaaaccagaggatgacaaccctgttgagaacgaggatgcctcc
gtacatgaaactgcttccttagaggagaggccagagaatcttcccgaggttgaagatggc
tccttgccgtcaggtacagcccctgatgaaaatgaagccagcgtagagcctcagcccagt
gctgaccagggcagcactgaattgtgtagctctcaagaagtcgatcagcccacaagtggc
acggacgcaggagcttctgacacatctgtaggaagccgcagagctgccagtgagactgag
tccctggaccagggatccgaaccttcccaggtgtcctctgagacagaacccagtgaccct
gcaaggacagagagtgtgagtgaggccagtaccagacccgagggagagagtgacctggaa
ggtgcagacagctcatgcaatgagagcgtgaccacacagctgtcctccgtggagacacgg
tgctcatctctagagagtgcacgatttccagaaaccccggccttttcttctcaggaagag
gaagatggggcctgcgcagctgagccgaccagcagcggccccacagaggggtcgcaggag
tctgtctgcactcccggttctttacctgctgtgcaggtgcccagcagggaagaggaaggg
tcgggggctgaagctactgctttatctgagcagggggagctgggggaggtctggcagagg
aggggcagtcttgagggagcagctgctgctgccactgctgctgccaccgatagccagccc
caggaagacggggatcctggtgatacacaaggtgcctgcgaaggggccaccgctcaggag
gagggcgccactggaggttctcaaaccaatggccatcagcccttgaggtcactaccttca
gtgcgccaggacgtcagccgataccagagggtggacgaggctctcccaccaaactgggaa
gcacgtattgacagccacggcagaatcttctacgtggaccatgtaaacagaaccacgacg
tggcagcggcctacagctccccctgccccacaggtcctgcagagatctaactccatacag
caaatggagcagctaaaccggcgttatcagagcatccgcagaaccatgacgaatgagagg
cctgaggaaaataccagtgctatcgatggggcaggggaagaagccgactttcaccaagcc
agcgcagacttccgtcgggagaacgtcctgccccactctacctccagatccaggctcacg
ctgctgttacagtcgccccctgtgaagttcctcatcagcccagagttcttcaccgtgctg
cattctaaccctagtgcctaccgcatgtttacaaacaacacgtgtttgaagcacatgatc
accaaagtccggcgggacacccaccactttgaacgctatcagcataacagggacctcgtg
ggattcctcaacatgtttgctaacaaacagctggaactaccaaggggctgggagatgaaa
cacgatcatcagggcaaggcattttttgtcgaccacaactcccgaaccaccacgttcatt
gatcctcggctcccacttcagagcagtaggcccacgagtgcgctggttcatcgacaacac
ctgacgaggcaacgcagtcacagcgcgggtgaggtaggagaagactctcggcatgcagga
ccacccgttcttcccaggccagccagtacattcaatacggtcagtaggccacagtaccag
gacatggttccagtggcctacaatgacaaaattgttgcgtttttgcgtcaacctaacatc
cttgaaattctgcaagagcgtcaacctgatcttgccagaaaccactcactcagggagaag
atccaatttatccgaactgaagggacccctggattggtgcggctctcaagtgatgcagat
cttgtcatgttactgagcttatttgaggaagaaataatgtcatatgtgcctcctcatgcc
ttactccaccccagctactgtcagtccccgcgtggctcccctgtgtcatctccccagaat
tcaccaggtactcagcgtgccaatgcccgggctcctgcaccttacaagagagattttgaa
gccaaactaaggaacttttataggaagttagaaactaaaggatacggacaaggcccagga
aaattaaagttaattatccgaagagaccacttgctggaagatgcttttaatcagattatg
ggctactccagaaaggacctgcagaggaataaactgtacgtcacctttgtcggggaggaa
gggttggattacagtgggccttccagagagtttttcttcctggtatcccgagaactcttt
aacccctattacggcttatttgaatattcagccaatgacacatacacagtacaaataagt
cctatgtctgcctttgtagacaatcatcatgaatggtttcgattcagtgggaggatcctc
ggtcttgcactaatacaccagtacttgttggacgccttctttacgcgacccttctataag
gctcttctcagaatcctgtgtgacctgagtgatctggaataccttgatgaggagttccac
cagagccttcaatggatgaaagacaatgacatccatgacatcctagacctcacgttcact
gtgaacgaagaagtttttgggcagattactgaacgagagttaaaaccagggggagccaat
attccagtgacggagaagaacaagaaggagtacattgagaggatggtgaagtggaggatt
gagaggggcgtggtgcagcagacagagagcttagtccgcggtttctatgaggtagtagat
gccaggctagtgtctgtctttgatgcaagagaactggagctggtcattgctggcacagct
gagatagatctcaatgactggaggaacaacactgaatacagaggcgggtaccatgacaat
cacattgtaattcggtggttctgggctgcagtagaacgattcaacaatgaacaacgacta
aggttgttacagtttgttacaggcacatctagcattccctatgaaggatttgcttctctc
cgagggagtaatggtccaagaagattctgtgtggaaaaatggggaaaaatcaccgctctt
cccagagctcacacgtgttttaaccgcctggatctccctccatacccttccttttccatg
ctttatgaaaaactcttgacagcagttgaagagaccagtaccttcggactcgagtga

DBGET integrated database retrieval system