KEGG   Rattus norvegicus (rat): 316409
Entry
316409            CDS       T01003                                 

Gene name
Hsfy2, Hsfy1
Definition
(RefSeq) heat shock transcription factor, Y linked 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: HSF_DNA-bind DUF2063
Other DBs
NCBI-GeneID: 316409
NCBI-ProteinID: NP_001012132
RGD: 1311885
Ensembl: ENSRNOG00000038569
UniProt: Q5XIQ7
Position
9q31
AA seq 393 aa
MAEAPSDMLDVSPNSLSTDSETSSGDPWCDNNTGQKDSELWAIIEESAFQVLAQRFLIKR
PPHTLCASEPDEDSNLFSMTFPRKLWKIVGSDKFKSIWWDEDGTYIVINEELFKKEVLER
KAPFRIFETDSMKSLVRQLNLYGFRKMRQNFQRSASLPDFLAEEKGISASCKLQFYQNPN
FLRDCPHLIERMKRRIGIKTVSRGAAPSLPDFKNKHFRPDLGKMDDHSLGVAVQTSERNL
LSGSSISNVYLRQKPSLTQGSSDSMDVIRSDFSLATSSSFRPPEEVLTHRPAPLNDVSSL
HMDSQRIYTQANDSTVNFIITSITQNRRDMSHLWNSCIEMQGEPSFQPGFPHFSSSSSTY
SDSKAKGEPELPIHKERVASTTLASTSNHHPSS
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggctgaggcaccttcggacatgctggatgtttcccctaacagtctatcaacggattcc
gagacctcttccggtgacccttggtgtgacaacaacacaggtcagaaggactcagagtta
tgggctattattgaggaaagtgcattccaggttttggctcagcgattcttgataaagagg
ccgcctcataccctctgtgcctcagagccagatgaagacagtaacttattttcaatgacc
ttccccagaaaactgtggaaaatagtgggaagtgacaaatttaagtctatttggtgggat
gaggatgggacttacatagtgatcaatgaagagctcttcaagaaggaagtgctggaaaga
aaggcccccttcagaatatttgaaactgatagcatgaaaagtctggttcgacaacttaat
ctgtatggatttaggaaaatgagacagaacttccagaggtctgcttctcttccagacttc
ctggctgaagaaaaaggaatttctgcctcatgtaagttacagttctaccagaacccaaac
tttctgcgagactgtccccatcttatagaaagaatgaaaaggagaattgggattaaaaca
gtttctcgtggagctgctccatcgcttccagatttcaagaacaaacacttcagaccagac
ttgggcaagatggatgaccatagtttgggtgtagctgtccaaaccagtgagaggaatctg
ttgtctggctctagtatttcaaatgtatatctgagacagaagccttctcttactcaaggg
agttctgattcgatggatgtcatcagaagtgacttttctctagcaacatcaagttccttc
aggccacctgaagaagtgctaacacatcgccctgctcctttaaatgatgtgtcctctctt
catatggactcacagagaatctacactcaagcgaatgacagcactgtgaatttcattata
acctctattacccaaaaccgcagggacatgtctcacttgtggaatagttgtattgaaatg
cagggagagccttcctttcaacctgggtttcctcatttttcatccagttcatctacttat
tctgactcaaaagccaaaggtgaacccgagttaccaatacacaaggaaagagtagcatct
accacgttggcatcgacatcaaaccatcacccatcttcgtga

DBGET integrated database retrieval system