KEGG   Rattus norvegicus (rat): 316516Help
Entry
316516            CDS       T01003                                 

Gene name
Tmbim1
Definition
(RefSeq) transmembrane BAX inhibitor motif containing 1
  KO
K06890  uncharacterized protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    316516 (Tmbim1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bax1-I BaxI_1
Motif
Other DBs
NCBI-GeneID: 316516
NCBI-ProteinID: NP_001007714
RGD: 1359409
Ensembl: ENSRNOG00000014797
Vega: OTTRNOG00000001505
UniProt: Q6AYE0
Position
9q33
AA seq 309 aa AA seqDB search
MSNPTAPPPYEDHNPLYPGRPPPGGYGQPSVLPGGYPAYPAYPQPGYGHPAGYPQPIPPV
HPMPMNYGHDYSEEERAGSDSFGPGEWDDRKVRHTFIQKVYCIISVQLLITVAIIAVFTF
VEPVSEYVRSNVAVYYVSYAVFIVTYLILVCCQGPRRRFPWNIILLTIFTLALGFMTGAI
SSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLICVLGIVLAVTGAVTSVVLF
FEYIYWLHMVYAGLGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIVYIFTF
VLQLVGNRD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatcccactgccccacctccctatgaggaccacaaccccctgtaccctggccgt
ccacctcctgggggctacggacagccgtctgtcctgcctggtggttaccctgcctacccc
gcctaccctcaacctggttacgggcaccctgctggctacccacagccgattcctcctgtc
catccaatgcccatgaactacggccatgactatagtgaggaggagagagcaggaagtgac
agctttggtcctggagaatgggatgaccggaaagtccgacataccttcatccaaaaggtg
tactgcatcatttctgtccagctgctcatcactgtggccatcattgctgtcttcaccttt
gtggaaccagtcagtgaatatgtgaggagcaatgtggcggtgtactacgtgtcctatgct
gtcttcattgtcacctacctgatccttgtctgctgccagggacccagacgccgattccca
tggaacattatcctgctaaccatctttactttggctttgggctttatgacaggcgctatt
tccagtatgtatgaaaccaaagctgtcatcattgctatgatcatcactgccgtggtatcc
atttctgtcaccatcttctgctttcagactaaggtggacttcacctcatgtacaggcctc
atctgtgtgctgggaatagtgttggcagtaaccggtgctgtcacaagcgtagtgctgttt
tttgaatatatttactggctccacatggtctacgcaggtctgggggccatctgtttcacc
ctgttcctggcttatgacacgcagctggtcctggggaaccggaagcataccatcagccca
gaggactacatcacaggcgccctgcagatctacacagatatagtctacatcttcaccttt
gtgctccagcttgtaggaaatcgagactga

DBGET integrated database retrieval system