KEGG   Rattus norvegicus (rat): 316526Help
Entry
316526            CDS       T01003                                 

Gene name
Wnt6
Definition
(RefSeq) wingless-type MMTV integration site family, member 6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    316526 (Wnt6)
   04390 Hippo signaling pathway
    316526 (Wnt6)
   04150 mTOR signaling pathway
    316526 (Wnt6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    316526 (Wnt6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    316526 (Wnt6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    316526 (Wnt6)
   05205 Proteoglycans in cancer
    316526 (Wnt6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    316526 (Wnt6)
   05226 Gastric cancer
    316526 (Wnt6)
   05217 Basal cell carcinoma
    316526 (Wnt6)
   05224 Breast cancer
    316526 (Wnt6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    316526 (Wnt6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    316526 (Wnt6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    316526 (Wnt6)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Morphogens
   316526 (Wnt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 316526
NCBI-ProteinID: NP_001101696
RGD: 1304559
Ensembl: ENSRNOG00000017409
UniProt: D4A3W9
Position
9q33
AA seq 365 aa AA seqDB search
MLPPVPSCLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGD
EKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgccggtgccctcctgcctcggactgctgctgctgctgctcttgtgccctgcg
cacgtcggtggactgtggtgggccgtgggcagccccctggtcatggatcctaccagcatc
tgcaggaaggccaggaggctggcaggaaggcaggctgagctgtgccaggcggagccggaa
gtagtggcagagcttgcccggggcgcaagactgggggttcgagaatgtcagttccagttc
cgtttccgacgctggaactgctccagtcacagcaaggcctttgggcgcgtcctgcagcag
gacattcgagagacagcttttgtgtttgcaattaccgctgcgggtgccagtcacgcggtc
actcaggcctgttccatgggagagctcctacagtgtggttgtcaggcaccccgcgggcgc
gcaccgcctaggccctccggccttctgggcactcctggacctccgggaccaactggctct
ccagatgccagcgcagcctgggagtggggaggctgcggagatgatgtcgactttggggat
gagaagtcaagactctttatggatgcacagcacaagcggggacgtggagatatccgtgct
ttggtgcaactgcataacaacgaggcaggcagactggcggtgcggagccacacgcgcacc
gagtgtaagtgccatgggctttcgggttcctgtgctctgcgcacctgctggcagaagctg
ccaccgttccgcgaggtgggcgcacggctgctggagcgcttccacggcgcctcacgcgtc
atgggcaccaacgacggcaaagctctgttgcctgcggtccgcaccctcaagcctcccggc
cgagccgatctcctctacgcagccgattcacccgacttctgcgcccccaaccggcgcacc
ggttcaccgggcacgcgcggccgcgcctgcaacagcagtgccccggaccttagcggctgc
gacctgttgtgctgcggtcgcggacaccgccaggagagcgtacagctcgaggagaactgc
ctgtgccgcttccactggtgctgcgtggtgcaatgccaccgctgccgcgtgcgcaaggag
ctcagcctgtgcctctga

DBGET integrated database retrieval system