KEGG   Rattus norvegicus (rat): 316527Help
Entry
316527            CDS       T01003                                 

Gene name
Wnt10a
Definition
(RefSeq) wingless-type MMTV integration site family, member 10A
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    316527 (Wnt10a)
   04390 Hippo signaling pathway
    316527 (Wnt10a)
   04150 mTOR signaling pathway
    316527 (Wnt10a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    316527 (Wnt10a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    316527 (Wnt10a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    316527 (Wnt10a)
   05205 Proteoglycans in cancer
    316527 (Wnt10a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    316527 (Wnt10a)
   05226 Gastric cancer
    316527 (Wnt10a)
   05217 Basal cell carcinoma
    316527 (Wnt10a)
   05224 Breast cancer
    316527 (Wnt10a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    316527 (Wnt10a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    316527 (Wnt10a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    316527 (Wnt10a)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Morphogens
   316527 (Wnt10a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 316527
NCBI-ProteinID: NP_001101697
RGD: 1307015
Ensembl: ENSRNOG00000052510
UniProt: D3ZRW5
Position
9q33
AA seq 417 aa AA seqDB search
MGSAHPRPWLRLPPGPQPRPELWALLFFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKVPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPAIPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRNRFHRATLI
RPHNRNGGQLEPGLAGAPSPAPGTPGLRRRASHSDLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSTGPDSCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctcccaccagggccccagccgcggcct
gagctctgggcgctcctgttcttcctactgctgctggctgctgctgtgcccaggtcagca
cccaacgacatcctgggcctccgcctacccccagagcctgtgctcaacgccaacacagtg
tgcctgacattgcccggcctgagccggcggcagatggaggtgtgtgtgcgtcaccctgac
gtggccgcctctgctatccagggcatccagatcgccatccatgagtgccagcatcagttc
cgggaccagcgctggaactgttccagcctggagactcggaacaaagtcccctacgagagc
cccatcttcagcagaggttttcgagagagtgctttcgcctacgccatagcagctgccggg
gtggtgcacgcagtgtccaacgcgtgcgccctgggtaaactgaaggcttgcggttgcgat
gcctccaggcgtggggacgaagaggcctttcgtcggaagctgcaccgcttgcagctggac
gccctacagcgcggaaagggcttgagccacggggtcccggagcaccctgccataccccct
gccagcccaggcctgcaggactcctgggagtggggtggctgcagtccggatgtgggcttt
ggagaacgcttctccaaggactttctggactcccgagagcctcacagagacatccacgca
cgcatgagactccacaacaaccgtgtgggcaggcaggcggtgatggagaacatgcggcga
aagtgcaagtgccacggcacctcaggcagctgccagctcaagacctgctggcaggtgacg
ccggagttccgcacagtgggggcgctgctgcgcaaccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggtggccagttggagcccggcctcgcgggagcaccctcgcca
gcaccgggtactccagggctgcgccgtagggccagtcactccgacctggtctactttgag
aaatcgcccgacttctgtgagcgcgagcctcgtctggactcggcaggcactgtggggcgc
ctgtgcaataagagcagcacgggtccagacagctgcggcagcatgtgctgtggccgcggt
cacaacattctgcgccagacgcgcagcgagcgctgccactgtcgtttccactggtgctgc
ttcgtggtctgcgaagaatgccgcatcactgagtgggtcagcgtctgcaagtga

DBGET integrated database retrieval system