KEGG   Rattus norvegicus (rat): 316578
Entry
316578            CDS       T01003                                 

Gene name
Slc16a14
Definition
(RefSeq) solute carrier family 16, member 14
  KO
K08190  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 14
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    316578 (Slc16a14)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   316578 (Slc16a14)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    316578 (Slc16a14)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 316578
NCBI-ProteinID: NP_001101699
RGD: 1309675
Ensembl: ENSRNOG00000017072
UniProt: D4A0E5
Position
9q35
AA seq 436 aa
MYTSHEDIGYDLEDDRKAKNKKTLKPHPDIDGGWAWMMVLSSFFVHILIMGSQMALGVLN
VEWLEEFHQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSA
YAANVQSLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVL
LKYLCAEYGWRNAMFIQGALSLNLCVCGALMRPLSPEKVENCSGAEEPCYFGTASLFTNR
MFVAFIFWALFAYSSFVIPFIHLPEIVSLYNLSEQNDAFPLTSIIAILHIFGKVILGAVA
DLPCISVWNVFLIANFTLVLSIFLLPLMHTYASLAVICALIGFSSGYFSLMPVVTEDLVG
TEHLANAYGIIICANGISALLGPPFAGWIFDITQKYDFSFYICGLLYMVGILFLLIQPCI
QMTEQSGRKCMDSAHV
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgtatacaagtcatgaagatatcgggtatgaccttgaggatgaccgaaaagctaagaat
aagaagaccctgaagccccacccggatatcgatggtgggtgggcctggatgatggtcctc
tcttccttttttgttcacatcctcatcatgggctcacagatggccctaggagtcctcaac
gtggagtggcttgaagaattccaccagagccgtggcctgaccgcttgggtcagctcccta
agcatgggcatcaccttgatcgtgggacctttcatcggcttgttcattaacacctgtggg
tgccgccagacagcaatcattggagggctggtgaactccctcggctgggtgctgagcgcc
tatgcagctaatgtgcagtctctctttattaccttcggagtggcagcaggcctcggcagt
gggatggcctacctgcctgcagtggtcatggtgggaaggtactttcagaagagacgagcc
ctggcccagggcctcagtaccacagggacaggatttgggacattcctgatgaccgtgctg
ctgaagtacctgtgtgcagaatatggctggcggaatgccatgttcatccaaggtgctctg
tccctgaacttgtgtgtttgtggggcgctcatgaggcccctctctcctgagaaagtagaa
aactgctcgggagcagaagagccatgctattttgggacagcctcgctcttcaccaaccgc
atgtttgtagcctttattttctgggctctgttcgcgtacagcagttttgtgatccctttc
atccacctgccagaaatcgtcagtctgtataacttgtcggaacaaaacgacgccttccct
ctgacctccattatagcaatacttcacatcttcgggaaggtaatcctgggggccgtggca
gacctcccctgtatcagcgtctggaacgtcttcctcatcgctaacttcaccctagtcctc
agcatcttcctcctgcccctgatgcacacctacgccagcctggctgtcatttgcgcccta
attgggttttctagcgggtatttctccctcatgcccgtggtgacggaggacctggttggc
actgagcacttggccaatgcctacggcatcatcatctgcgccaatggcatctcagcctta
ctaggaccgccattcgcaggatggatcttcgacatcacccaaaaatacgacttctccttt
tatatatgtggtttgctttacatggtagggatactctttttgctcatccagccgtgtatt
cagatgactgaacaatccggaaggaagtgcatggacagtgcacatgtttag

DBGET integrated database retrieval system