KEGG   Rattus norvegicus (rat): 316583
Entry
316583            CDS       T01003                                 

Gene name
B3gnt7
Definition
(RefSeq) UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
  KO
K09664  beta-1,3-N-acetylglucosaminyltransferase 7 [EC:2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00533  Glycosaminoglycan biosynthesis - keratan sulfate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    316583 (B3gnt7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    316583 (B3gnt7)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     316583 (B3gnt7)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   316583 (B3gnt7)
SSDB
Motif
Pfam: Galactosyl_T Fringe DUF604
Other DBs
NCBI-GeneID: 316583
NCBI-ProteinID: NP_001012134
RGD: 1310580
Ensembl: ENSRNOG00000018267
UniProt: Q66H69
Position
9
AA seq 397 aa
MSLWKKTLYKSVCLALALLVAVTVFQRSVTPGQFLQDPLPPTLGPPKTGSLVNPNSFWKS
SKDVVAPTPTVPRGPQVWDVVTTNCSINVNLTHQPWFQNLEPHFRQFLAYQHCRYFPMLL
NHPEKCAGDVYLLVVVKSVITQHDRREVIRQTWGHEWESAGPDRGAVRTLFLLGTASKQE
ERTHYQQLLAYEDRLYGDILQWDFLDSFFNLTLKEIHFLKWLDIYCPNVPFIFKGDDDVF
VNPTNLLEFLSDRQPQENLFVGDVLKHARPIRKKDNKYYIPAVMYSKATYPPYAGGGGFL
MSGSLARQLHHACDTLELFPIDDVFLGMCLEVLGVKPTGHEGFKTFGISRVRGSRMNKEP
CFYRSMLVVHKLLPAELLAMWDLVHSNLTCSLKFQVL
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtctctgtggaagaaaaccctctacaagagtgtatgcctggctctggccctccttgtg
gctgtcaccgtattccagcgcagtgtgacccctggtcaattccttcaggatcctctacca
cccacgctagggccacccaaaactggaagtctggtcaaccccaacagcttctggaagagt
tcaaaggatgtagtggctcccacccccacggttcctcggggaccccaggtctgggatgtg
gttaccactaactgctctatcaatgtcaacctgacccatcagccctggttccagaatctc
gagccacacttccggcagttcctagcctatcagcattgtcgatatttccccatgttgcta
aaccacccggagaagtgtgccggcgatgtctatctgcttgtggttgtcaagtcagtcatc
acacagcatgaccgccgagaggtcattcgtcagacctggggccacgaatgggagtcagca
ggtccagacaggggggccgtgcggactctcttcctgctcggcacagcctccaagcaagag
gagcgaacccactatcagcagctgctggcctatgaggaccgtctctatggcgacatccta
cagtgggacttccttgacagcttcttcaacctgactctcaaggagatccacttcctcaag
tggcttgacatttactgtcccaatgtccccttcattttcaaaggtgatgatgatgtcttt
gtcaaccccaccaacctgctcgagtttctgtctgaccggcagccccaggaaaacctattc
gtaggtgatgttctgaaacatgctcgacccatccgcaaaaaagataacaaatactacatc
cccgccgtcatgtacagcaaggccacctacccaccctatgccggcggcgggggtttcctc
atgtctggcagcctggctcggcaactccaccacgcctgtgacacactggaactcttccct
attgatgacgtcttcctgggcatgtgcttggaggtgctgggagtgaagcccacaggccac
gagggcttcaagaccttcggtatctctcgggtccgaggcagccgaatgaacaaggagcca
tgcttctaccgatccatgctcgtggttcacaagctgctgcctgccgagctgctggccatg
tgggatctggtacatagcaatcttacctgttctctcaagttccaggtgctctaa

DBGET integrated database retrieval system