KEGG   Rattus norvegicus (rat): 316626Help
Entry
316626            CDS       T01003                                 

Gene name
Hes6
Definition
(RefSeq) hes family bHLH transcription factor 6
  KO
K09087  hairy and enhancer of split 2/6/7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    316626 (Hes6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    316626 (Hes6)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    316626 (Hes6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Hairy_orange
Motif
Other DBs
NCBI-GeneID: 316626
NCBI-ProteinID: NP_001013197
RGD: 1312047
Ensembl: ENSRNOG00000020194
UniProt: Q5PPN0
Position
9q36
AA seq 234 aa AA seqDB search
MRTVGKHGGTARCGQGLRVDGPAGGCTGQGLSSRFPQARKPLVEKKRRARINESLQELRL
LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGYIQCMHEVHTF
VSTCQAIDATVSAELLNHLLESMPLREGSSFRDLLGDSLAGLPGGSGRSSWPPGGSPESP
LSSPPGPGDDLCSDLEEIPEAELNRVPAEGPDLVPTSLGILTTARRAQSVWRPW
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccgttgggaagcacggggggaccgcaaggtgcggacaggggctgcgggtggat
gggcctgcgggaggctgcacgggccaggggctcagtagccgtttcccacaggcccggaag
cccctggtggagaagaagcgacgcgcgcggatcaacgagagtcttcaggagttgcggctg
ctgctagcgggcaccgaggtgcaggccaagctagagaacgccgaggtgctggagctgacc
gtgcgacgcgtgcagggcgctctgcgaggccgggctcgcgagcgggagcagctgcaggct
gaagcaagcgagcgcttcgctgctggctacatccaatgcatgcatgaggtgcacacgttc
gtgtccacgtgccaagccatcgatgccactgtctcagctgaactcctgaaccacctgcta
gagtccatgccgctgcgcgagggtagcagctttcgggatctgctgggggactccctagct
gggctgcccggaggctctgggaggagcagctggcctccaggagggtccccagagtcccca
ttgtccagtcccccaggtcccggggacgacctgtgttctgacctagaggagatcccggag
gctgaactaaaccgggtgcctgccgaggggccagatttggtgcccacatccttaggcatc
ctgaccacagctcgccgggcccagagtgtgtggagaccttggtga

DBGET integrated database retrieval system