KEGG   Rattus norvegicus (rat): 316639
Entry
316639            CDS       T01003                                 

Gene name
Farp2
Definition
(RefSeq) FERM, RhoGEF and pleckstrin domain-containing protein 2
  KO
K06082  FERM, RhoGEF and pleckstrin domain protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    316639 (Farp2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    316639 (Farp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    316639 (Farp2)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   316639 (Farp2)
SSDB
Motif
Pfam: RhoGEF PH FERM_C FERM_N FA FERM_M PH_13 IQ_SEC7_PH PH_11
Other DBs
NCBI-GeneID: 316639
NCBI-ProteinID: NP_001101703
RGD: 1308003
Ensembl: ENSRNOG00000018051
UniProt: D3ZFK8
Position
9
AA seq 1060 aa
MGEIEGTYRTLPTSGTRLGGQTAIGVSTLEPEQALSPKMQEKHMHIRVKLLDSTVEIFDI
EPKCDGQVLLTQVWKHLNLIECDYFGLEFKNVQSYWIWLEPMKPIIRQVRKPKNAVLRLA
VKFFPPDPGQLQEEYTRYLFALQLRRDLLEERLTCTATTSALLISHLLQSEIGDYDETLD
REHLKANDYLPNQEQSLDKILDFHQRHTGQTPADSDFQVLEIARKLEMYGIRFHMASDRE
GTKINLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEHHTFFRLSDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYIRDGGT
KRIPYERRHSKTRTSLHTLTGDLPKQSISFTDGLRTSASLSSANASFYPPPTSLSSPGLP
SVKDSSSSPVDPQAPHIKSTAAERSSRPSSSEGPSTQSAHLPGPPVLQPGPGFSVDSPQP
SPSSLKSRLSLSPERQASLSTAEQGSSPVLSPVLSGTGTARMDNQEEQKHKHTSEDEAYF
IAKEIVATERTYLKDLEVITVWFRSVVIKEEAMPAALMTLLFSNIDPIYEFHRGFLHEVE
QRLALWEGPSSGDHQRIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKHCKRLEAVYK
EFELQKVCYLPLNTFLLKPVQRLVHYRLLLNRLCTHYSPEHEDYTDCHEALKAITEVTTE
LQQSLTRLENLQKLTELQRDLVGVENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSDML
LYTSKSVTGASQFRIRGFLPLRGMLVEDSENEWSVPHCFTIYAAQKTIVVAASTRLEKEK
WMQDLNAAIQAAKSAGDTPAVLLGGPVYTRSPRSSDEVSLEDSEDGRGTRGSLEGNSQHR
ANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTH
QDDYPLASLPLLGYSVSLPREADSIHKDYVFKLQFKSHVYFFRAESKYTFERWMEVIKRA
SSSPGRPPSFTQDCSHLSPGLEAEVREKEACPSLCLDKNL
NT seq 3183 nt   +upstreamnt  +downstreamnt
atgggggagatagaaggaacatacagaactttaccaacgtcagggacacgcttgggtggc
cagaccgccattggagtgagtaccctggaaccagagcaggccctctctcccaagatgcag
gagaagcacatgcacatcagagtgaagctgctggacagtactgtggaaatatttgacatt
gagcctaagtgtgacggacaggtcttattgacgcaagtgtggaagcatttgaatctgatt
gaatgtgactactttggtctggagttcaagaacgtccagtcttactggatttggcttgaa
cctatgaaacccatcattcggcaagtgcgaaagcctaagaatgcagtgcttcgcctggca
gtaaaatttttcccacctgaccctggtcagttgcaagaagagtacacaaggtacctgttt
gccttgcaacttaggagagacctcctagaggaacgcctgacctgcacggccaccacttcc
gcccttctcatatcccaccttctgcagtcggaaatcggagattatgatgaaaccctggat
cgagaacacctcaaagccaatgactacttgcccaaccaggagcaatccctggacaagata
ctcgacttccatcaaaggcacacgggccagactcctgcggactcagatttccaggtgctt
gagattgcaagaaagttggaaatgtatggcatcaggtttcacatggcttctgacagagaa
gggaccaagattaatctggcagtttctcacatgggcgtcctcgtgttccagggcaccacc
aaaatcaatactttcaactggtccaaagtccgtaaactaagcttcaagaggaaaaggttt
cttatcaaactccaccctgaggtccatgggccctaccaggacacgttagagttcttgttg
ggtagcagagatgaatgtaagaatttctggaagatatgtgtagaacaccacacctttttc
agactctctgaccagcctaagccaaaggcaaaagctgtcttcttcagtcggggctcctcc
ttcagatacagtggaagaactcagaaacaactggtagactatatcagagacggtgggacg
aagagaattccatacgaaagacggcacagtaagactcggacgtctcttcatactctgact
ggagatctgcctaaacagagcatctcattcaccgatggcttgagaacttctgcctccctg
tcttcagcaaatgcctccttttatccaccccctacttctttgtcctctcctggtctgccc
agtgtgaaggacagcagcagctcccctgtggatccccaggctccccacatcaagagcaca
gcagcagagaggagcagcagaccatcatcatctgaaggccccagcacacagtcggcccat
ctccctggaccccctgtgctccagcctggtccaggcttttctgtggatagtcctcagcct
tctccctccagcctgaagagccgcctgagcctgagccctgagcgtcaggcctctctgagc
acagctgagcagggttcgtcccctgtgctaagccctgtcctcagtggcactgggacagcc
aggatggacaaccaagaagagcagaaacacaagcacacatcggaagacgaggcctatttc
atagccaaggagattgttgccacagagcgaacctacctgaaggacctagaagttatcact
gtgtggttccgaagtgtggtgatcaaggaggaggccatgcctgcagccctgatgaccctg
cttttctccaacattgatcccatctacgagttccatcgaggcttccttcacgaggtggaa
cagaggctggcactctgggaagggccatctagcggtgatcatcaacggattggggacatc
ctcctcaggaacatgcggcagttaaaggaatttactagctacttccaaagacacgatgag
gtcctaacagaactggaaaaggccacaaaacactgtaaaaggctggaggcggtctacaaa
gagtttgagctccagaaggtttgctacctgcctctcaacacgttcctgctgaagcccgtc
cagaggctcgtgcactaccgtctgctgctaaaccggctgtgtactcactactcacctgag
cacgaggactacactgactgccacgaggcactgaaggccatcacagaagtgaccactgag
ctccagcagagccttacccggctggaaaacctacagaagctgacagagctgcagcgagac
ctggttggtgtagaaaacctcatcgctcctggaagggagttcatccgtgagggctgcctt
cacaagctcaccaagaagggcctgcaacagaggatgttttttctgttctcagatatgttg
ctgtatacaagcaaaagtgtcacaggggccagtcagttccggattcgtggcttccttcca
ctccgtggcatgctggtagaagacagtgagaacgaatggtctgttcctcattgcttcact
atctatgcagctcagaaaacaatcgtggtggcagccagcactcggctagaaaaggagaag
tggatgcaggacctgaatgcagcaatccaggcagccaagagcgctggtgacacacccgcc
gtgctgctgggtggcccggtgtatactcgtagccccagatcttctgatgaagtctctctg
gaagattcagaagatggtcgaggaacccggggctccctagaggggaacagtcagcaccgg
gccaataccacaatgcatgtgtgctggtatcggaacacgagtgtgtccagagcggaccac
agtgcagctgttgagaaccagctttcaggatatctgcttaggaagttcaagaacagtaat
ggctggcagaagctctgggtggtctttaccaacttctgcttgtttttctataaaacacat
caggatgactaccccctggccagcctcccactactgggttacagtgtgagcctccccaga
gaggctgacagcatccacaaagactatgttttcaagctccaattcaaatctcacgtctac
ttcttccgggctgagagcaagtacacatttgaaaggtggatggaagtcatcaaaagagcc
agcagctcaccagggagacccccaagtttcactcaggactgttcacatctttctccaggg
ctggaggcagaagtcagagaaaaggaggcatgtccttcactctgcttggacaagaaccta
tga

DBGET integrated database retrieval system