KEGG   Rattus norvegicus (rat): 316643
Entry
316643            CDS       T01003                                 

Gene name
Chchd2
Definition
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 2
  KO
K22758  coiled-coil-helix-coiled-coil-helix domain-containing protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    316643 (Chchd2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   Others
    316643 (Chchd2)
SSDB
Motif
Pfam: CHCH DUF2076 Cmc1
Other DBs
NCBI-GeneID: 316643
NCBI-ProteinID: NP_001015019
RGD: 1309819
Ensembl: ENSRNOG00000051180
Vega: OTTRNOG00000001000
UniProt: Q5BJB3
Position
9q36
AA seq 154 aa
MPRGSRSRTSRVTPPASRAPQMRAAPRRAPAAQPPATAAAPSAVGSPAAAPRQPGLMAQM
ATTAAGVAVGSAVGHTLGHAITGGFSGGANAEPARPDITYQEPQGAPLQNQQSFGPCSLE
IKQFLECAQNQSDVKLCEGFNEVLRQCRIANGLI
NT seq 465 nt   +upstreamnt  +downstreamnt
atgccgcgtggaagccgaagccgcacttcccgggtgactcctccggccagccgggcccct
cagatgagggctgctcccagaagagcaccagcagctcagcctccagccacagctgccgcc
ccatctgcagtcggctcacctgctgctgcccctcggcagccaggcctgatggcccagatg
gctaccactgcagccggtgtggctgtgggttctgcggtggggcacaccctgggtcacgcc
atcactgggggcttcagcggaggggctaatgctgagcctgcgaggcctgacatcacttac
caggagcctcagggagccccgctgcagaaccagcagtcttttggaccttgctctctagag
atcaagcagtttctggagtgtgctcagaaccagagcgatgtcaagctctgtgagggcttc
aatgaggtgctgcggcagtgcaggattgcaaatggtttaatctaa

DBGET integrated database retrieval system