KEGG   Rattus norvegicus (rat): 316742Help
Entry
316742            CDS       T01003                                 

Gene name
Tgif1, Tfig, Tgif
Definition
(RefSeq) TGFB-induced factor homeobox 1
  KO
K19383  homeobox protein TGIF1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    316742 (Tgif1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    316742 (Tgif1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, TGIF
    316742 (Tgif1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox_KN Homeodomain Homez
Motif
Other DBs
NCBI-GeneID: 316742
NCBI-ProteinID: NP_001015020
RGD: 1310517
Ensembl: ENSRNOG00000015906
UniProt: Q5BJZ9
Position
9q38
AA seq 287 aa AA seqDB search
MIYTSRRCALAGSGWPSRHGVVAAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKE
SVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDP
NQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGP
ILARPSVICHTTVTALKDGPFSLCQAVSVGHSTDVQQVAPSNFTDASLRYPEDTCKSGPS
PNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKQAAEMELQAKLTA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgatttacacgagcaggaggtgtgcattggcggggtccggctggccttcgcgtcacggt
gttgttgcagcagcatccggcagtgactctgaggatgaagacagtatggacagtcccttg
gacctttcatcgtcagcggcctctggcaagagaaggaggagaggcaatctgcccaaagag
tccgtccagattcttcgagactggctgtatgaacacagatacaacgcatacccctcagag
caagagaaagccctgctgtcgcagcagacacacctgtccacactacaggtctgtaactgg
ttcatcaacgcccgtcgcaggctccttcctgacatgctgagaaaggatggcaaagaccca
aatcagttcaccatttcccgccgaggggccaagatctcagaagctagctctattgaagct
gcaatgggtatcaaaaacttcatgccaactctagaagagagcccatttcattcctgcgta
gttggacccaacccaaccctagggagaccagtgtctcccaaacctccctccccgggaccc
atcttggctcgcccctcagtgatctgccataccactgtgactgcattgaaggacgggcct
ttctctctctgccaggcagtcagtgtgggacatagtacagatgtacagcaggtagcaccc
agcaactttacagacgcctctctcaggtacccagaggacacttgcaaatctggacccagt
ccaaatcctcagagtggtcttttcaacactcctcccccgactccgccagacctcaaccag
gattttagtggatttcagctcctggtggacgttgcgctcaagcaggcagcagagatggag
cttcaggccaaactcacagcttaa

DBGET integrated database retrieval system