KEGG   Rattus norvegicus (rat): 316742
Entry
316742            CDS       T01003                                 

Gene name
Tgif1
Definition
(RefSeq) homeobox protein TGIF1
  KO
K19383  homeobox protein TGIF1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    316742 (Tgif1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    316742 (Tgif1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain TALE
    316742 (Tgif1)
SSDB
Motif
Pfam: Homeobox_KN Homeodomain Homez
Other DBs
NCBI-GeneID: 316742
NCBI-ProteinID: NP_001015020
RGD: 1310517
Ensembl: ENSRNOG00000015906
UniProt: Q5BJZ9
Position
9
AA seq 287 aa
MIYTSRRCALAGSGWPSRHGVVAAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKE
SVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDP
NQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGP
ILARPSVICHTTVTALKDGPFSLCQAVSVGHSTDVQQVAPSNFTDASLRYPEDTCKSGPS
PNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKQAAEMELQAKLTA
NT seq 864 nt   +upstreamnt  +downstreamnt
atgatttacacgagcaggaggtgtgcattggcggggtccggctggccttcgcgtcacggt
gttgttgcagcagcatccggcagtgactctgaggatgaagacagtatggacagtcccttg
gacctttcatcgtcagcggcctctggcaagagaaggaggagaggcaatctgcccaaagag
tccgtccagattcttcgagactggctgtatgaacacagatacaacgcatacccctcagag
caagagaaagccctgctgtcgcagcagacacacctgtccacactacaggtctgtaactgg
ttcatcaacgcccgtcgcaggctccttcctgacatgctgagaaaggatggcaaagaccca
aatcagttcaccatttcccgccgaggggccaagatctcagaagctagctctattgaagct
gcaatgggtatcaaaaacttcatgccaactctagaagagagcccatttcattcctgcgta
gttggacccaacccaaccctagggagaccagtgtctcccaaacctccctccccgggaccc
atcttggctcgcccctcagtgatctgccataccactgtgactgcattgaaggacgggcct
ttctctctctgccaggcagtcagtgtgggacatagtacagatgtacagcaggtagcaccc
agcaactttacagacgcctctctcaggtacccagaggacacttgcaaatctggacccagt
ccaaatcctcagagtggtcttttcaacactcctcccccgactccgccagacctcaaccag
gattttagtggatttcagctcctggtggacgttgcgctcaagcaggcagcagagatggag
cttcaggccaaactcacagcttaa

KEGG   Rattus norvegicus (rat): 499929
Entry
499929            CDS       T01003                                 

Gene name
Tgif2
Definition
(RefSeq) homeobox protein TGIF2
  KO
K19553  homeobox protein TGIF2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    499929 (Tgif2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    499929 (Tgif2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain TALE
    499929 (Tgif2)
SSDB
Motif
Pfam: Homeobox_KN Homeodomain
Other DBs
NCBI-GeneID: 499929
NCBI-ProteinID: NP_001128455
RGD: 1560115
Ensembl: ENSRNOG00000042374
UniProt: B5DEL6
Position
3
AA seq 237 aa
MSDSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNL
SVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSLLAVSVPA
PTNMLSLSVCSMPLHSGQGEKPAASFPQVELESPKALVTPGSTLTLLTRAEAGSPTGGLF
NTPPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQDPAPPLLHTPLPLVSENAK
NT seq 714 nt   +upstreamnt  +downstreamnt
atgtcggacagcgatctaggcgaggatgaaggtcttctgtcactgactggcaagaggaag
cgcagggggaacctgcccaaggagtcagtaaagattctccgagactggctgtatctgcac
cgctacaacgcctacccctctgagcaggagaagctaagcctctctggacagaccaacctc
tccgtgctgcagatatgtaactggttcatcaatgcccgccgccgccttctccctgacatg
cttcggaaggatggcaaagaccctaatcagttcaccatctcccggcgcgggggtaaggcc
tcagatgtggctctccccaggggcagcagcccctctctgctggctgtgtctgttccagcc
cccaccaacatgctctccttgtctgtgtgttccatgccactccactcaggccaaggtgaa
aagccagcagcgtccttcccacaagtggagctggagtcccccaaggccctggtgacccct
gggagcacactcaccctgctgactagggcagaggctggaagccccacaggtggactcttc
aatacgccaccacccacacccccagagcaggacaaggacgacttcagcagcttccagttg
ctggtggaggtggcgctgcagagggctgctgagatggagcttcagaagcagcaagatcca
gcgccacccttactacacactccgctccctctagtctcagaaaatgccaagtag

DBGET integrated database retrieval system