KEGG   Rattus norvegicus (rat): 316982
Entry
316982            CDS       T01003                                 

Gene name
RGD1309621
Definition
(RefSeq) similar to hypothetical protein FLJ10652
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF4617
Other DBs
NCBI-GeneID: 316982
NCBI-ProteinID: XP_006237769
RGD: 1309621
Ensembl: ENSRNOG00000036913
UniProt: E9PU57
Position
4q44
AA seq 1509 aa
MSWNAKPENAVAKPPKFSKTQSSILQQFLMTSTTSQSSFSYPAHNQEACMYSSNSNSVSQ
PLLSGRNYMTPQTQISVSNMPSRTIVTSQSSMEGVVCTNVKGPQQPNHNLQTVSSGVMQN
VWFGSSVKNFMPSHTEATISHNPDGRTNMPYMQTPQSQLVTSDTYSMQLQMVPFNSGKVP
VAYQGNQGLNHFIPDQLADWTQYTSSELTYPEYRPPLKQYSRILPATTSLQVKNNPLPTY
TQALQSKHSAPLSSHPYAAETSKRLSALPYSCRYGSQHVQNTQPVSKHLPMEVPQSPEVH
SSEKKQDSYRGFKQQWQNPNESFTIGKFSDLKINAKQSYSDTVRSSGDGVQALVQNNQEK
RKYPYSPSTNQVIDTNATKEKLARDIKSLVEIKKKFTELARKIKINKSLLMAAGCSKTAN
TSYTEPIQHSEFSAKEMSAKNGNDCSMELLATCLSLWKNQPPKTTEENVPKPLEEKQCNT
SRISTTVVGSSHPTNEVHVKSFCSGVGNSQKLLSSSQTILSVLTPSGESSGVAVGKGTEL
QIAVVSPLVLADTNPLPGKELAPEVLPEPPYPVVKEGSICSLQHQQAETAALPFHITGVV
ADSNLSVEMSLPAQKEKQHKPTQGDPDIADHGLGKLSPLGTEAVPNSVDSTTVSGPMLQI
ESICSLAEGDVSYNSQIAEIFNSVQNEPEKPSPNQVINNQQEQVDGTTENKDFSLQKDKK
YIRYTYVPREITEQPEVLQPEEPASCEYVEANTETIEESGRECSGGKESTAEDVCSPAGF
QQDPHPQETDSLSNKSAHCLPAVNEINDESEPVSYLHDQLSELLKEFPYGIETVSRHEVS
VDQKKTHKILENETGDKTSNVFGDSTDQIKITVLNSEQIKELFPEEDQPCDLDKLAEPEG
KNVAEVKSPCDSQVPREESHDFGMLDPEKDKIHCCALGWLSMVYEGVPKCHCSSNEEKGK
DQCLDMNSCKQGEQPCNNGITIFEINPVSNNPKTPLTQAAEKGHFSEMHGDKTKGSKTKD
SREEQQHFSAKCYKKDKDNLKMRHDSSLKMEQKLKNTSSECDRLNPSKSSKIATPEILHV
KTSNSDKNMSFFKQASQESLQRKPTSQDSNPVKAPVELPSNTDPCRRNTSLVQFVSPEKK
KLKFKAGGSRLKYFEKRKTDNMIIPDVEIKKKKYEKQEQNKNAGETLKLCSALRESNERA
SVQENAIPSPESSDSKGSSLKSTRVITVQEYLQRRKDKHVTGSDASGNICVENVLCNSEH
MKTSKDSAEISWEKSADGQSIRAETSKEPGHNSTIHGKAFKIHHSEVSRTHSVSSNSKGK
QPDKIYKARTSNEHSQVPLQVKEQRKQYLNRVAFKCTERESICLTKLDSASKKLSTEKKE
SEAHTLKTKNIDKPSMLEFKLCPDVLLKNTSSVDKQDEPEPKKEKAPVQVSGIKSTKEDW
LKCIPTRTKMPESSQEIDSAGSRLSKRSFSADEFETLQNPVKDSNVMFRTYKKMYLEKRS
RSLGSSPVK
NT seq 4530 nt   +upstreamnt  +downstreamnt
atgagttggaatgcaaaaccagagaatgctgttgccaaacccccaaagttttctaaaacg
cagtcatctatattacaacagtttttaatgacttctacaacttctcaaagttcttttagc
tatcctgcccataaccaagaagcatgcatgtattccagtaactcaaattcagtttcccag
ccacttctgagcggcagaaattatatgactcctcagactcagatctctgtttctaacatg
cctagtaggacaattgtgacctcacagtcttcaatggaaggagttgtatgtacaaatgtt
aaagggccccaacaaccaaaccacaatttgcagacagtgtcttcaggagttatgcagaat
gtctggtttggctcatccgtgaagaattttatgccttcccatacagaagcaaccatatcc
cataatcctgatggaaggactaatatgccttacatgcaaacaccacagagtcagctcgtc
acatcagatacctattctatgcaactgcaaatggttccttttaattctggaaaagttcct
gtagcgtatcaaggaaatcagggactcaatcacttcataccagatcagctggctgactgg
acacagtatacatccagtgaactaacttatccagaatacaggccacctctgaagcaatac
tcccgcatactgccagccactacatcattacaagttaaaaataatccgcttccaacttac
acacaggccttacagtcaaagcattctgcacctttgtcttcacatccatatgctgcagaa
accagcaaaagactctctgcccttccttacagctgtagatatggaagccaacatgtacaa
aatactcagcctgtttctaaacacttgcctatggaagtccctcagagtccagaagtgcac
tcatctgaaaaaaagcaagattcttacagaggctttaaacagcagtggcagaaccccaat
gaatcattcaccattggaaaattctctgatttgaaaataaatgccaagcagtcttatagt
gacactgttagatcttctggggatggtgttcaggcgcttgttcaaaataatcaagagaaa
agaaaatatccctacagtccaagtacaaatcaagtaatagacacaaatgccacaaaagaa
aaactggcgagggatattaaatcactagtagaaataaaaaagaagtttacagaacttgca
agaaaaattaaaattaataaaagtcttttgatggcagctggttgtagtaaaacagccaat
acttcttatactgaaccaattcagcattctgaattttcagcaaaagaaatgtctgctaaa
aatggcaacgactgctccatggaattgctagcaacatgcctttctctttggaaaaaccaa
cctccaaaaaccacagaagaaaatgtcccaaaacctttagaagaaaaacagtgtaacacc
tcacgaatcagtacaacggtagttggcagttcacatcccacaaacgaagttcacgttaag
agtttttgttctggtgttgggaattctcagaaactgctgagctcatcacaaacaatattg
tcagttctcactccgagtggtgagtcttcaggtgtagctgttggaaaaggaacagagctt
cagattgctgtggtgtcacctttagttcttgcagatactaatcccttacctggaaaagag
ttagcgcctgaagttttaccagaaccgccgtatccagttgttaaggaaggtagtatttgt
agcttacaacaccaacaggcagaaactgctgctttaccttttcacattacaggagtagta
gcagatagtaacctgtcagtggagatgtctctgcctgctcaaaaggaaaagcagcataaa
ccaacacagggtgatccagacatagctgatcatggtttaggaaaactttctcccctgggt
accgaagctgtgcctaactctgtggatagcaccacagtgagtggacccatgttacagatt
gaaagtatctgttctcttgcagaaggggatgtatcttacaattcccagatagcagagata
ttcaactctgtacaaaatgagcccgagaaaccttcacctaatcaggtaattaataatcaa
caagaacaagtagatggcaccactgaaaataaagactttagccttcagaaagataagaag
tatatacggtatacatatgttcctcgtgagatcactgagcagccagaggtgctgcagcct
gaagagccagcatcttgtgagtacgtggaagcaaacacagaaaccatagaggaaagcggt
agggaatgcagtggtggaaaagaaagcacagctgaggatgtctgttcaccggctggtttt
cagcaggatcctcaccctcaggaaactgatagtttaagcaataagtcagcccactgtctg
cctgcagtaaacgagattaatgatgaaagtgaacctgtctcatacctacatgaccagctg
tcagaacttttaaaagagttcccttatggcattgaaactgttagcaggcatgaagtgtct
gtggaccaaaaaaagacacacaaaatcttagaaaatgaaactggcgataagactagtaac
gtgtttggggatagcacagaccaaataaaaattacagtgttaaactctgaacaaatcaaa
gaactgtttcccgaagaggatcagccctgtgacttagacaagttggcagaacctgagggg
aaaaatgttgcagaagtgaagagcccatgtgactcacaggtccccagagaagaaagccat
gactttggaatgttggacccagagaaagacaaaatccattgctgtgccttgggttggctc
tcaatggtttatgagggtgtgccaaagtgtcattgcagttccaatgaagagaaggggaaa
gaccagtgtttggatatgaacagctgcaaacaaggagagcagccctgtaataatggaatc
actatttttgaaattaatcctgtttctaataaccccaaaactcctctgacccaagcagct
gagaaaggccatttttctgaaatgcatggtgataagaccaaaggatctaaaacaaaagac
agcagagaggaacagcaacatttttcagctaaatgttacaaaaaagataaagataattta
aaaatgagacatgatagctcactgaaaatggagcaaaaactaaaaaatacttcatctgaa
tgtgacagactaaatccctcaaaaagcagtaaaatagcaacccccgaaatacttcatgta
aaaacttccaattctgataaaaatatgtcattttttaaacaagcttctcaggaaagccta
cagagaaaacccacttcccaagattcgaatccagtaaaagcacctgtagaacttccttca
aatacagatccatgcaggaggaacacctcattggtacagtttgtgtcaccagaaaagaaa
aaactaaaattcaaagcaggtggctccagactgaaatattttgaaaaaagaaagacagac
aacatgattataccagatgtggagataaaaaagaagaaatatgaaaagcaagagcagaac
aaaaacgctggagagacactcaaattgtgcagtgctctgagggaatccaatgaaagagcc
agtgttcaagagaacgctatcccaagtcctgagtcctcagactctaagggcagctccttg
aagagtactagagttataacagtgcaggagtatttacaacggcggaaagacaaacatgta
actgggagtgacgcttccggaaacatttgtgtagaaaatgtgttgtgtaactctgaacac
atgaagaccagcaaggattctgcagaaataagctgggaaaagtcagctgacgggcagagc
atccgtgcagagacctcaaaagaaccaggacataattctaccatccatggtaaagctttc
aagatccaccattctgaagtgtctagaacacacagtgtgtcaagtaatagtaaagggaag
cagcctgacaaaatctataaggcccgtacgagtaatgagcacagccaggtgcctcttcag
gtaaaggaacaaaggaaacagtacttgaatcgagttgcatttaaatgcacggaacgggaa
agcatatgtctcacaaagttggacagtgcatccaagaagcttagtacagagaaaaaggag
agtgaggcacatacactcaagacaaaaaacatagacaaacctagtatgctagagtttaaa
ttatgtccagacgtactattgaagaacacaagctctgttgacaagcaggatgagcctgag
cctaagaaagagaaagcacctgtgcaagtttcaggaataaaaagtacaaaagaagactgg
ttaaagtgcatccctacaaggacaaagatgcctgaatcaagccaagaaatagatagtgct
ggctcaagactttctaagagaagcttcagcgcagatgaatttgaaacactacaaaaccca
gtaaaagactcaaatgtcatgttccggacctacaaaaagatgtaccttgagaagagaagc
agaagcctcgggagtagtccagttaaatag

DBGET integrated database retrieval system