KEGG   Rattus norvegicus (rat): 317163
Entry
317163            CDS       T01003                                 

Gene name
Eif1a
Definition
(RefSeq) eukaryotic translation initiation factor 1A
  KO
K03236  translation initiation factor 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    317163 (Eif1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    317163 (Eif1a)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-1
    317163 (Eif1a)
SSDB
Motif
Pfam: eIF-1a
Other DBs
NCBI-GeneID: 317163
NCBI-ProteinID: NP_001008773
RGD: 1306331
Ensembl: ENSRNOG00000031421
UniProt: Q566D5
Position
18q11
AA seq 144 aa
MPKNKGKGGKNRRRGKNENEPEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVRRLCH
IRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
FGPGDDDEIQFDDIGDDDEDIDDI
NT seq 435 nt   +upstreamnt  +downstreamnt
atgccaaagaataaaggcaaaggaggcaaaaacaggcgcagaggtaaaaatgaaaatgaa
cctgagaagagagagttagtgtttaaagaggatgggcaagagtatgctcaggtgatcaaa
atgctgggaaacggacggttggaagcaatgtgctttgacggtgtgcggaggctgtgccac
ataagagggaagttgagaaaaaaggtttggataaacacctcagacattatactgattggt
ctacgagactaccaagacaacaaggctgacgtaatcttaaagtacaatgcagacgaagca
agaagtctgaaggcatatggagaacttccagaacatgccaaaatcaatgaaacggacaca
tttggtcctggggatgacgatgaaatccagtttgatgatattggagatgatgatgaagac
attgatgatatctaa

DBGET integrated database retrieval system