KEGG   Rattus norvegicus (rat): 317218
Entry
317218            CDS       T01003                                 

Gene name
Itm2a
Definition
(RefSeq) integral membrane protein 2A
  KO
K18241  integral membrane protein 2A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    317218 (Itm2a)
SSDB
Motif
Pfam: BRICHOS PTEN_C2
Other DBs
NCBI-GeneID: 317218
NCBI-ProteinID: NP_001020883
RGD: 1559423
Ensembl: ENSRNOG00000002365
UniProt: Q4KLJ2
Position
Xq22
AA seq 263 aa
MVKIAFNTPTAVQKEEARQDVEALVSRTVRAQILTGKELRVVPQEKDSSSGRCMLTLLGL
SFILAGLIVGGACIYKYFMPKSTIYHGEMCFFDSEDAVNSIHGGQPYFLPVTEEADIRED
DNIAIIDVPVPSFSDSDPAAIIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMTPKNLVELF
GKLASGKYLPHTYVVREDLVAVEEIRDVSNLGIFIYQLCNNRKSFRLRRRDLLLGFNKRA
IDKCWKIRHFPNEFIVETKICQE
NT seq 792 nt   +upstreamnt  +downstreamnt
atggtgaagatcgccttcaacacccccacggcggtgcaaaaggaggaggctcggcaagat
gtggaggcactcgtcagccgcactgtccgagctcaaatcctgactggcaaggagctcaga
gtcgtcccgcaggagaaagatagctcgtctgggagatgtatgcttactctcttaggcctc
tcgttcatcttggcaggactgattgttggtggagcctgcatttataagtacttcatgccc
aagagcaccatttaccatggtgagatgtgcttctttgactctgaggatgctgtaaattcc
attcatggaggacagccatactttctgcctgtgactgaggaagccgatattcgtgaggat
gacaacatcgcaatcattgacgtgcccgttcccagtttctccgacagtgaccctgcggca
attattcacgactttgagaagggaatgactgcttacctggacttgcttttgggaaactgt
tacctgatgcccctcaacacttccattgtgatgactccaaagaatctggtggagcttttt
ggcaaactggcaagtggcaagtatttgcctcatacttatgtggttcgtgaagacctggtt
gctgtggaagaaattcgtgatgttagtaaccttggtatttttatttaccaactttgcaac
aaccgaaagtccttccgccttagacgcagagacctcctgctgggtttcaataagcgtgcc
attgacaaatgctggaagatcagacacttccccaatgaattcatcgtcgaaaccaagatc
tgtcaagagtga

DBGET integrated database retrieval system