KEGG   Rattus norvegicus (rat): 317274Help
Entry
317274            CDS       T01003                                 

Gene name
Mageb16, Snca
Definition
(RefSeq) MAGE family member B16
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MAGE DUF3098 Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 317274
NCBI-ProteinID: NP_001020184
RGD: 1562365
Ensembl: ENSRNOG00000029408
Vega: OTTRNOG00000002340
UniProt: Q6AY37
Position
Xq21
AA seq 360 aa AA seqDB search
MSQKNPEYAADHDHTREEMQNLQVAPASSDVEEPCSSSHLMASSLKGHTSEETQVPEDME
EPCSSSQLLTASNQEDPAYETPSTSRGLQHPYVSSSESAKGLGNKEMQGNSVIPPDQPDL
PVMTIDGKVNFLVNYMLYKYQVKEMMSMNDIMTLIVREDEHHFHEILMRASERMEMVFGL
EVREVDPVNHFYALFIKLGLTYDGMRADEYSFPKTGLLILILGVVFMKGNRATEEEIWEV
LNPMGIYAGMNHFIFGDPRELLTDDFVREQYLAYQPIANSDPIQYEYVWGPRAKAETSKM
KVLEFVAKVHGSDPTVFPSQYEEALIEEEERTLAMILEQAGPSSASGESSSDMGSNVPHI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaagaatccagaatatgcagctgaccacgaccatacccgtgaagagatgcag
aacctacaggttgcaccagcctccagcgatgttgaggagccatgttcctcatctcatctt
atggctagtagtctgaagggccataccagtgaagagacccaggtccctgaggatatggaa
gaaccatgttcctcctctcaacttcttactgctagcaaccaggaagatcctgcatatgag
acacccagtacttctaggggtcttcagcatccctatgtctcttcaagtgagtctgccaag
ggtcttggtaacaaagaaatgcagggtaactcagtcattccaccagatcagccagattta
cctgtgatgaccatagatgggaaagttaatttcttggtgaattatatgctgtacaaatat
caggtgaaagagatgatgagcatgaacgatataatgacactcattgtcagagaagatgaa
catcattttcatgaaatcctcatgagagcttctgagcgcatggaaatggtctttgggctt
gaagtgagggaagtagatcctgtcaaccatttctatgctctctttatcaaattaggtctc
acctatgatgggatgagagctgatgagtatagctttcctaagactggtctcctgatactc
atcctgggtgtagtcttcatgaagggcaaccgtgcaactgaagaggagatttgggaagtg
ttaaatccaatgggaatctatgctggaatgaatcatttcatctttggggaccccagagag
ctgctaactgatgactttgtgagggagcaatacctggcataccagccaatagccaatagt
gatcccatacagtatgaatatgtgtgggggccacgggctaaagctgaaactagtaagatg
aaagtgttagagtttgtggccaaggttcatgggtcagaccctactgtgttcccttctcag
tatgaagaggctctgatagaagaagaagagagaacccttgccatgattttagaacaagct
ggcccgagttctgcttctggtgaaagttctagtgacatgggcagcaatgtccctcacatc
tag

DBGET integrated database retrieval system